wanderlustnoosa.com

value of wanderlustnoosa.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

wanderlustnoosa.com was registered 5 years 1 month ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, wanderlustnoosa.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 172
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 90 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
Wanderlust Noosa – F.K.A Zeitlustalpengesit Hof

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 20 Sep 2019 23:11:45 GMT
Server: Apache
X-Powered-By: PHP/7.2.20
Link: <http://wanderlustnoosa.com/wp-json/>; rel="https://api.w.org/", <http://wanderlustnoosa.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 4665
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-09-20 5 years 1 month 2 weeks ago
Last Modified: 2019-09-20 5 years 1 month 2 weeks ago
Expiration Date: 2021-09-20 3 years 1 month 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns69.domaincontrol.com 97.74.104.45 United States
ns70.domaincontrol.com 173.201.72.45 United States

DNS Record Analysis

Host Type TTL Extra
wanderlustnoosa.com A 10799 IP: 43.255.154.9
wanderlustnoosa.com NS 3600 Target: ns70.domaincontrol.com
wanderlustnoosa.com NS 3600 Target: ns69.domaincontrol.com
wanderlustnoosa.com SOA 599 MNAME: ns69.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019091901
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

Hip Hop Dance - The Origin Hip Hop Academy

- originhhpaa.com

Hip Hop Dance and Performing Arts Academy with Hip Hop Curriculum dance studio El Cajon San Diego

alexa 5,468,637  worth $240.00

Salter Group - Social Marketing Tool

- otoekspert.com

Salter Group - Social Marketing Tool

alexa 5,423,406  worth $240.00

Design Your Own Unique Map Print - OwnPoster

- ownposter.com

Print your own street, city or memorable place with special meaning for you. Perfect gift for settlers, travellers and dreamers.

alexa 3,176,900  worth $480.00

Home - Paddlefreak

- paddlefreak.com

alexa 4,024,240  worth $240.00

Pain Mentor

- painmentor.com

alexa 4,454,748  worth $240.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: WANDERLUSTNOOSA.COM
Registry Domain ID:
2435240651_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.godaddy.com
Registrar URL:
http://www.godaddy.com
Updated Date:
2019-09-20T00:09:10Z
Creation Date:
2019-09-20T00:09:09Z
Registry Expiry Date:
2021-09-20T00:09:09Z
Registrar: GoDaddy.com, LLC
Registrar
IANA ID: 146
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status:
clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server:
NS69.DOMAINCONTROL.COM
Name Server:
NS70.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-09-20T23:11:44Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.