wanderlustnoosa.com

value of wanderlustnoosa.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

wanderlustnoosa.com was registered 5 years 1 month ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, wanderlustnoosa.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 172
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 90 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
Wanderlust Noosa – F.K.A Zeitlustalpengesit Hof

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 20 Sep 2019 23:11:45 GMT
Server: Apache
X-Powered-By: PHP/7.2.20
Link: <http://wanderlustnoosa.com/wp-json/>; rel="https://api.w.org/", <http://wanderlustnoosa.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 4665
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-09-20 5 years 1 month 2 weeks ago
Last Modified: 2019-09-20 5 years 1 month 2 weeks ago
Expiration Date: 2021-09-20 3 years 1 month 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns69.domaincontrol.com 97.74.104.45 United States
ns70.domaincontrol.com 173.201.72.45 United States

DNS Record Analysis

Host Type TTL Extra
wanderlustnoosa.com A 10799 IP: 43.255.154.9
wanderlustnoosa.com NS 3600 Target: ns70.domaincontrol.com
wanderlustnoosa.com NS 3600 Target: ns69.domaincontrol.com
wanderlustnoosa.com SOA 599 MNAME: ns69.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019091901
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

Iwritefy — Coming Soon

- iwritefy.org

alexa 10,219,284  worth $8.95

Смотреть онлайн фильмы в хорошем качестве hd1080 бесплатно

- kinovhod.site

Онлайн кинотеатр киновход, даёт возможность смотреть фильмы онлайн в хорошем hd качестве 720, 1080. Бесплатно кино на пк, телефоне, планшете, телевизоре не новшество.

alexa 10,251,177  worth $8.95

coolsculpting-deals.com - coolsculpting-deals Resources and...

- coolsculpting-deals.com

coolsculpting-deals.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here,...

alexa 10,540,974  worth $8.95

Best Free Streaming Movies and TV Shows Online

- buyutmovies.xyz

Watch movies and tv series stream full hd online for free

alexa 223,744  worth $42,660.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: WANDERLUSTNOOSA.COM
Registry Domain ID:
2435240651_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.godaddy.com
Registrar URL:
http://www.godaddy.com
Updated Date:
2019-09-20T00:09:10Z
Creation Date:
2019-09-20T00:09:09Z
Registry Expiry Date:
2021-09-20T00:09:09Z
Registrar: GoDaddy.com, LLC
Registrar
IANA ID: 146
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status:
clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server:
NS69.DOMAINCONTROL.COM
Name Server:
NS70.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-09-20T23:11:44Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.