yudycambodia.com

value of yudycambodia.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

yudycambodia.com was registered 4 years 7 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, yudycambodia.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 5
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 100 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

:: Aditiya DEALER::

- aditiyadealer.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-09-16 4 years 7 months 2 weeks ago
Last Modified: 2019-09-19 4 years 7 months 2 weeks ago
Expiration Date: 2020-09-16 3 years 7 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns35.domaincontrol.com 97.74.107.18 United States
ns36.domaincontrol.com 173.201.75.18 United States

DNS Record Analysis

Host Type TTL Extra
yudycambodia.com A 10800 IP: 43.255.154.9
yudycambodia.com NS 3600 Target: ns36.domaincontrol.com
yudycambodia.com NS 3600 Target: ns35.domaincontrol.com
yudycambodia.com SOA 600 MNAME: ns35.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019091900
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

Tutorix - The Best Learning App

- tutorix.com

Tutorix, The Best Learning App Brings You Simply Easy Learning at your Mobile and Tabs, The Best learning App for 6th - 12th Classes, NEET and IIT/JEE Exams

alexa 458,019  worth $5,040.00

Ads-Microsoft.Com Tempat Pasang Iklan Baris Gratis Tanpa daftar

- ads-microsoft.com

Pasang Iklan Gratis Di Ads-Microsoft.Com Tanpa Daftar Langsung Tampil rumah tanah mobil motor dijual obral komputer laptop bisnis online internet marketing

alexa 17,932,361  worth $8.95

Nissan Jadetabek – Dealer Resmi Nissan Depok

- nissanjadetabek.com

alexa 13,944,810  worth $8.95

HK - Entertainment Updates

- hindike.com

Hindi Movies, Movie Review, Box Office Collection, Movie News, Movie Release Date, movie trailer review etc.

alexa 239,362  worth $39,960.00

XVIDA - Wireless charging docks, magnetic mounts, iPhone cases & more

- xvida.com

Charge up your iPhone or Samsung with the best magnetic wireless phone chargers, optimized to support fast wireless charging in the car, at home or on the go.

alexa 1,391,316  worth $480.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: YUDYCAMBODIA.COM
Registry Domain ID:
2433969568_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.godaddy.com
Registrar URL:
http://www.godaddy.com
Updated Date:
2019-09-19T20:58:32Z
Creation Date:
2019-09-16T18:23:52Z
Registry Expiry Date:
2020-09-16T18:23:52Z
Registrar: GoDaddy.com, LLC
Registrar
IANA ID: 146
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status:
clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server:
NS35.DOMAINCONTROL.COM
Name Server:
NS36.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-09-26T14:17:46Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.