timirnaha.com

value of timirnaha.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

timirnaha.com was registered 4 years 8 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, timirnaha.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 2,000
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 80 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
My blog – Just another WordPress site

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: 7 H4 Headings: Not Applicable
H5 Headings: 5 H6 Headings: 5
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 21 Sep 2019 04:25:01 GMT
Server: Apache
X-Powered-By: PHP/7.2.20
Link: <http://timirnaha.com/wp-json/>; rel="https://api.w.org/", <http://timirnaha.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 7358
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-09-19 4 years 8 months 17 hours ago
Last Modified: 2019-09-19 4 years 8 months 17 hours ago
Expiration Date: 2021-09-19 2 years 7 months 4 weeks ago

Domain Nameserver Information

Host IP Address Country
ns21.domaincontrol.com 97.74.100.11 United States
ns22.domaincontrol.com 173.201.68.11 United States

DNS Record Analysis

Host Type TTL Extra
timirnaha.com A 10799 IP: 43.255.154.9
timirnaha.com NS 3600 Target: ns22.domaincontrol.com
timirnaha.com NS 3600 Target: ns21.domaincontrol.com
timirnaha.com SOA 599 MNAME: ns21.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019091901
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

Operation Project X – private encryption software

- operationprojectx.com

alexa 16,748,952  worth $8.95

Index of /

- premiumresellermxn.com

alexa 6,619,698  worth $8.95

Welcome to nginx!

- stepizmir.com

alexa 11,007,433  worth $8.95

LocalBitcoins.com: Fastest and easiest way to buy and sell bitcoins

- localbiticolns.net

Get bitcoins. Fast, easy and safe. Near you.

alexa 13,022,585  worth $8.95

Corporate Videos and Filmmakers in Mumbai / Navi Mumbai

- digitalstudio.in

HD Corporate videos,films, AV makers with industrial videos, photography services company in Mumbai / Navi Mumbai. Call 98205 78189

alexa 2,131,981  worth $240.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: TIMIRNAHA.COM
Registry Domain ID:
2434908328_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.godaddy.com
Registrar URL:
http://www.godaddy.com
Updated Date:
2019-09-19T10:23:02Z
Creation Date:
2019-09-19T10:23:01Z
Registry Expiry Date:
2021-09-19T10:23:01Z
Registrar: GoDaddy.com, LLC
Registrar
IANA ID: 146
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status:
clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server:
NS21.DOMAINCONTROL.COM
Name Server:
NS22.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-09-21T04:25:10Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.