rabsalhouse.com

value of rabsalhouse.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

rabsalhouse.com was registered 4 years 9 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, rabsalhouse.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 78 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 2
H3 Headings: 4 H4 Headings: 1
H5 Headings: 4 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 13
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 08 Sep 2019 13:18:08 GMT
Server: Apache
X-Powered-By: PHP/5.6.40
Link: <http://rabsalhouse.com/wp-json/>; rel="https://api.w.org/", <http://rabsalhouse.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 13541
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-09-06 4 years 9 months 3 hours ago
Last Modified: 2019-09-06 4 years 9 months 3 hours ago
Expiration Date: 2024-09-06 2 months 3 weeks 6 days from now

Domain Nameserver Information

Host IP Address Country
ns63.domaincontrol.com 97.74.101.42 United States
ns64.domaincontrol.com 173.201.69.42 United States

DNS Record Analysis

Host Type TTL Extra
rabsalhouse.com A 10798 IP: 43.255.154.9
rabsalhouse.com NS 3600 Target: ns63.domaincontrol.com
rabsalhouse.com NS 3600 Target: ns64.domaincontrol.com
rabsalhouse.com SOA 598 MNAME: ns63.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019090603
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

RedTube Bokep Indo Terbaru | Nonton Bokep Jepang Online FREE 2019

- redtubebokep.info

RedTube Bokep Indo Terbaru Download Bokep Jepang Online FREE 2019 ,bokep indonesia streaming bokep nonton bokep bokep online bokep barat vidio bokep Korea bokep terbaru bokep...

alexa 10,979,131  worth $8.95

to0ls-spam.online - This website is for sale! - to0ls-spam...

- to0ls-spam.online

This website is for sale! to0ls-spam.online is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to...

alexa 9,875,459  worth $8.95

Смотреть порно в онлайн. Порнуха в HD - отборное порно видео в HD...

- pornovau.fun

ПорноВау - это каталог лучшего порно видео в HD качестве, смотри сочное и новое порно видео каждый день в HD качестве! Мы отбираем для вас только лучшие ролики отборной порнухи.

alexa 81,308  worth $102,240.00

Home - Tech Savvy Belize

- techsavvybz.com

Tech Savvy Belize designs and develops the most beautiful responsive website for your business for an affordable rate. Tech Savvy got you covered!

alexa 8,233,956  worth $8.95

BoiTrade |

- boitrade.com

alexa 8,343,506  worth $8.95

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: RABSALHOUSE.COM
Registry Domain ID:
2430430388_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.godaddy.com
Registrar URL:
http://www.godaddy.com
Updated Date:
2019-09-06T07:45:41Z
Creation Date:
2019-09-06T07:45:41Z
Registry Expiry Date:
2024-09-06T07:45:41Z
Registrar: GoDaddy.com, LLC
Registrar
IANA ID: 146
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status:
clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server:
NS63.DOMAINCONTROL.COM
Name Server:
NS64.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-09-08T13:18:13Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.