kokkattillodge.com

value of kokkattillodge.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

kokkattillodge.com was registered 6 years 3 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, kokkattillodge.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 67 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
Kokkattil Lodge | Home :: Bed & Breakfast

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 7 H4 Headings: 9
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 11
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2018-07-18 6 years 3 months 3 weeks ago
Last Modified: 2018-07-18 6 years 3 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns69.domaincontrol.com 97.74.104.45 United States
ns70.domaincontrol.com 173.201.72.45 United States

DNS Record Analysis

Host Type TTL Extra
kokkattillodge.com A 10794 IP: 43.255.154.9
kokkattillodge.com NS 3600 Target: ns69.domaincontrol.com
kokkattillodge.com NS 3600 Target: ns70.domaincontrol.com
kokkattillodge.com SOA 3600 MNAME: ns69.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2018071806
Refresh: 28800
Retry: 7200
Expire: 604800
kokkattillodge.com MX 600 Priority: 10
Target: mx.zoho.com
kokkattillodge.com MX 600 Priority: 20
Target: mx2.zoho.com
kokkattillodge.com MX 600 Priority: 50
Target: mx3.zoho.com
kokkattillodge.com TXT 600 TXT: v=spf1 include:zoho.com ~all

























Similarly Ranked Websites

Sunlitt

- sunlitt.com

alexa 18,462,376  worth $8.95

neet-curioso.com

- neet-curioso.com

alexa 6,476,781  worth $8.95

turadiobautista.com

- turadiobautista.com

alexa 10,218,309  worth $8.95

Velkommen til Uteplassen

- ute-plassen.com

Overnatting i Sogndal og Sogndalsdalen, leiligheter, hytter og camping i Sogndal

alexa 3,423,898  worth $240.00

Shopper Home page - banners

- bluechiptoy.com

Default Description

alexa 3,297,001  worth $240.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: KOKKATTILLODGE.COM
Registry Domain ID: 2287097171_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-07-18T18:13:00Z
Creation Date: 2018-07-18T18:12:59Z
Registry Expiry Date: 2019-07-18T18:12:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server: NS69.DOMAINCONTROL.COM
Name Server: NS70.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/
>>> Last update of whois database: 2018-07-22T09:52:25Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.