himalayadarjeelingtea.com

value of himalayadarjeelingtea.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

himalayadarjeelingtea.com was registered 4 years 8 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, himalayadarjeelingtea.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 452
Bing Backlinks: 2
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 54 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
Himalaya Darjeeling Tea

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 24
H3 Headings: 9 H4 Headings: 5
H5 Headings: 4 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 104
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 13 Sep 2019 05:03:24 GMT
Server: Apache
X-Powered-By: PHP/7.2.20
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 10682
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: BigRock Solutions Ltd
Registration Date: 2019-09-11 4 years 8 months 1 week ago
Last Modified: 2019-09-11 4 years 8 months 1 week ago
Expiration Date: 2020-09-11 3 years 8 months 6 days ago

Domain Nameserver Information

Host IP Address Country
ns37.domaincontrol.com 97.74.108.19 United States
ns38.domaincontrol.com 173.201.76.19 United States

DNS Record Analysis

Host Type TTL Extra
himalayadarjeelingtea.com A 10800 IP: 43.255.154.9
himalayadarjeelingtea.com NS 3600 Target: ns37.domaincontrol.com
himalayadarjeelingtea.com NS 3600 Target: ns38.domaincontrol.com
himalayadarjeelingtea.com SOA 599 MNAME: ns37.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019091101
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

CareMetro

- caremetrotest.org

CareMetro, developed by RevelationMD, is TXCIN’s preferred tool to assist and inform the TXCIN membership on how to be successful in TXCIN’s Value Based contracts.

alexa 7,102,308  worth $240.00

maiconmirandaoficial

- maiconmirandaoficial.com

alexa 15,041,169  worth $8.95

CỘNG ĐỒNG CHA MẸ CHÂN THÀNH LOVE

- thanhvien.love

alexa 13,015,315  worth $8.95

Home

- domexsms.com

domexsms.com

alexa 5,535,311  worth $240.00

Home | X-Game - Conquer Online Private Server

- xgame-co.com

The first Conquer Online private server with Chi, Jiang Hu, Epic Weapons, CTF, Poker, Roulette, etc.

alexa 6,891,494  worth $240.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: HIMALAYADARJEELINGTEA.COM
Registry Domain ID:
2432102781_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Whois.bigrock.com
Registrar URL:
http://www.bigrock.com
Updated Date:
2019-09-11T08:59:08Z
Creation Date:
2019-09-11T08:39:48Z
Registry Expiry Date:
2020-09-11T08:39:48Z
Registrar: BigRock Solutions
Ltd
Registrar IANA ID: 1495
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact
Phone: +1.2013775952
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Name Server:
NS37.DOMAINCONTROL.COM
Name Server:
NS38.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-09-13T05:03:15Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.