harishaktidesign.com

value of harishaktidesign.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

harishaktidesign.com was registered 4 years 8 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, harishaktidesign.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 3
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 93 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
My blog – Just another WordPress site

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 6
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 06 Oct 2019 07:06:17 GMT
Server: Apache
X-Powered-By: PHP/7.2.20
Link: <http://www.harishaktidesign.com/wp-json/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 3719
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-10-01 4 years 8 months 3 weeks ago
Last Modified: 2019-10-01 4 years 8 months 3 weeks ago
Expiration Date: 2020-10-01 3 years 8 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns11.domaincontrol.com 97.74.105.6 United States
ns12.domaincontrol.com 173.201.73.6 United States

DNS Record Analysis

Host Type TTL Extra
harishaktidesign.com A 10798 IP: 43.255.154.9
harishaktidesign.com NS 3600 Target: ns11.domaincontrol.com
harishaktidesign.com NS 3600 Target: ns12.domaincontrol.com
harishaktidesign.com SOA 598 MNAME: ns11.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019100200
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

403 Forbidden

- hirewomenbook.com

alexa 16,621,315  worth $8.95

All Quotes Wishes

- allquoteswishes.com

Our Best Love Quotes In Hindi,Cute Whatsapp Status,Romantic Whatsapp Status In Hindi collection will make you fall for these. Visit Us for more.

alexa 6,472,817  worth $240.00

CREATIONS

- ragenventi.com

alexa 6,697,452  worth $240.00

Home - Etussy Online Courses

- etussytraining.com

alexa 18,001,151  worth $8.95

Social viral

- socialviralkese.ooo

alexa 8,545,807  worth $240.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: HARISHAKTIDESIGN.COM
Registry Domain ID: 2439180644_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-10-01T13:11:19Z
Creation Date: 2019-10-01T13:11:18Z
Registry Expiry Date: 2020-10-01T13:11:18Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server: NS11.DOMAINCONTROL.COM
Name Server: NS12.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/
>>> Last update of whois database: 2019-10-06T07:06:13Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.