flameproof.asia

value of flameproof.asia is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

flameproof.asia was registered 5 years 10 months ago. It is a domain having .asia extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, flameproof.asia is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 100 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

Domain Information

Domain Registrar: DotAsia
Registration Date: 2018-08-06 5 years 10 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns65.domaincontrol.com 97.74.102.43 United States
ns66.domaincontrol.com 173.201.70.43 United States

DNS Record Analysis

Host Type TTL Extra
flameproof.asia A 10798 IP: 43.255.154.9
flameproof.asia NS 3600 Target: ns66.domaincontrol.com
flameproof.asia NS 3600 Target: ns65.domaincontrol.com
flameproof.asia SOA 3600 MNAME: ns65.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2018060703
Refresh: 28800
Retry: 7200
Expire: 604800
flameproof.asia MX 3600 Target: mail.flameproof.asia
flameproof.asia TXT 3600 TXT: v=spf1 a mx ptr
include:secureserver.net~all

























Similarly Ranked Websites

Online Compilers | C/C++/Java & more | Fresh2Refresh.com

- compilers.fresh2refresh.com

Online Compilers - C compiler, C++ compiler, Java Compiler, SQL editor, JavaScript, PHP, Python, C#, CSS, RUBY, Objective-C, Pascal, PERL, VB.NET, HTML

alexa 50,052  worth $313,200.00

Home - Tellus Matrix Group

- tellusmatrix.com

alexa 10,119,166  worth $240.00

Forums - Pinoytechies.com

- pinoytechies.com

alexa 1,507,505  worth $960.00

4 Hour Course Driver Education

- 4hourcourse.com

alexa 2,472,463  worth $480.00

PutUrMoneyWhereUrMouthIs – Just another WordPress site

- puturmoneywhereurmouthis.com

alexa 11,224,226  worth $240.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: FLAMEPROOF.ASIA
Registry Domain ID: D425500000048790380-AGRS
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-06-08T04:16:20Z
Creation Date: 2018-06-08T04:16:19Z
Registry Expiry Date: 2019-06-08T04:16:19Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Domain Status: serverTransferProhibited
https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registrant Organization: FERRAL COMMERCE
Registrant State/Province: Karnataka
Registrant Country: IN
Name Server: NS65.DOMAINCONTROL.COM
Name Server: NS66.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2018-06-08T22:05:39Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.