evergreen-n.com

value of evergreen-n.com is about $8.95
BeHR | Best WordPress theme for human resources management
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

BeHR | Best WordPress theme for human resources management evergreen-n.com was registered 4 years 8 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, evergreen-n.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 49,700,000
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 87 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
BeHR | Best WordPress theme for human resources management

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: 4 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 20 Oct 2019 11:39:33 GMT
Server: Apache
X-Powered-By: PHP/7.2.20
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 12958
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-10-14 4 years 8 months 1 week ago
Last Modified: 2019-10-14 4 years 8 months 1 week ago
Expiration Date: 2020-10-14 3 years 8 months 6 days ago

Domain Nameserver Information

Host IP Address Country
ns47.domaincontrol.com 97.74.103.24 United States
ns48.domaincontrol.com 173.201.71.24 United States

DNS Record Analysis

Host Type TTL Extra
evergreen-n.com A 10799 IP: 43.255.154.9
evergreen-n.com NS 3600 Target: ns48.domaincontrol.com
evergreen-n.com NS 3600 Target: ns47.domaincontrol.com
evergreen-n.com SOA 599 MNAME: ns47.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019101402
Refresh: 28800
Retry: 7200
Expire: 604800
evergreen-n.com MX 3600 Target: evergreenn-com02c.mail.protection.outlook.com
evergreen-n.com TXT 3600 TXT: v=spf1include:spf.protection.outlook.com
-all


























evergreen-n.com TXT 3600 TXT: NETORGFT5672347.onmicrosoft.com



























Similarly Ranked Websites

Çamaşır Yıkama Evi | 0531 987 30 16 – ND2S

- camasiryikamaevi.com

alexa 19,360,556  worth $8.95

Quicken Support Phone Number 1-855-376-8777 Techncial service Help

- quickcustomerservices.com

Any Problem In Quicken Software then dial Quicken Support Phone Number 1-855-376-8777 get instant help from our Quicken Customer Helpline toll free number.

alexa 1,382,718  worth $960.00

406 Not Acceptable

- tehranhome.net

alexa 11,190,472  worth $240.00


Fedtothewolves – Just another WordPress site

- fedtothewolves.com

alexa 11,877,677  worth $8.95

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: EVERGREEN-N.COM
Registry Domain ID:
2443447101_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.godaddy.com
Registrar URL:
http://www.godaddy.com
Updated Date:
2019-10-14T14:09:54Z
Creation Date:
2019-10-14T14:09:54Z
Registry Expiry Date:
2020-10-14T14:09:54Z
Registrar: GoDaddy.com, LLC
Registrar
IANA ID: 146
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status:
clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server:
NS47.DOMAINCONTROL.COM
Name Server:
NS48.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-10-20T11:39:35Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.