elcmall.com

value of elcmall.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

elcmall.com was registered 4 years 8 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, elcmall.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 214
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 75 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
ELC Mall Electronics controller shop

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-09-30 4 years 8 months 2 weeks ago
Last Modified: 2019-09-30 4 years 8 months 2 weeks ago
Expiration Date: 2022-09-30 1 year 8 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns17.domaincontrol.com 97.74.108.9 United States
ns18.domaincontrol.com 173.201.76.9 United States

DNS Record Analysis

Host Type TTL Extra
elcmall.com A 10800 IP: 43.255.154.9
elcmall.com NS 3600 Target: ns18.domaincontrol.com
elcmall.com NS 3600 Target: ns17.domaincontrol.com
elcmall.com SOA 600 MNAME: ns17.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019093007
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

machakospay.com - machakospay Resources and Information.

- machakospay.com

machakospay.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, machakospay.com...

alexa 16,020,623  worth $8.95

English Attack! | Apprenez l'anglais avec des extraits de films et...

- fr.english-attack.com

Notre pédagogie innovante vous immerge dans un anglais authentique et nos exercices interactifs et divertissants maintiennent votre motivation au plus hau...

alexa 288,357  worth $17,820.00

Đại lý xe HYUNDAI đạt tiêu chuẩn 3S duy nhất tại miền Bắc

- hyundai-motor.vn

Hyundai Grand i10, Hyundai accent, hyundai alantra, hyundai kona, hyundai tucson, hyundai santafe, hyundai solati, hyundai porter 150

alexa 15,061,818  worth $8.95

Flora ZOA

- florazoa.com

alexa 4,592,550  worth $240.00

The Mawazo Institute

- mawazoinstitute.org

alexa 6,003,152  worth $8.95

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: ELCMALL.COM
Registry Domain ID: 2438801021_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-09-30T11:36:22Z
Creation Date: 2019-09-30T11:09:38Z
Registry Expiry Date: 2022-09-30T11:09:38Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server: NS17.DOMAINCONTROL.COM
Name Server: NS18.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/
>>> Last update of whois database: 2019-10-02T22:54:19Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.