elcmall.com

value of elcmall.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

elcmall.com was registered 4 years 8 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, elcmall.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 214
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 75 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
ELC Mall Electronics controller shop

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-09-30 4 years 8 months 3 weeks ago
Last Modified: 2019-09-30 4 years 8 months 3 weeks ago
Expiration Date: 2022-09-30 1 year 8 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns17.domaincontrol.com 97.74.108.9 United States
ns18.domaincontrol.com 173.201.76.9 United States

DNS Record Analysis

Host Type TTL Extra
elcmall.com A 10800 IP: 43.255.154.9
elcmall.com NS 3600 Target: ns18.domaincontrol.com
elcmall.com NS 3600 Target: ns17.domaincontrol.com
elcmall.com SOA 600 MNAME: ns17.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019093007
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

kingmovies.net

- kingmovies.net

alexa 7,439,324  worth $8.95

دارالترجمه رسمی | ترجمه مدارک ، مقالات و متون به سایر زبانها -...

- darotarjome.com

دارالترجمه رسمی آنلاین و حضوری ارائه دهنده خدمات ترجمه مدارک و اسناد برای سفارت ها و دانشگاها ، ارزانترین دارالترجمه رسمی برای ترجمه مدارک تحصیلی و ویزا

alexa 3,327,931  worth $240.00

Trang chủ - Smile Shop 6789

- smileshop6789.com

alexa 1,670,179  worth $480.00

Welcome to campinggeneralstorenews.com

- campinggeneralstorenews.com

Welcome to campinggeneralstorenews.com

alexa 4,883,740  worth $240.00

Meridian Institute – Meridian Institutes

- meridianinstitutes.com

alexa 2,102,658  worth $240.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: ELCMALL.COM
Registry Domain ID: 2438801021_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-09-30T11:36:22Z
Creation Date: 2019-09-30T11:09:38Z
Registry Expiry Date: 2022-09-30T11:09:38Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server: NS17.DOMAINCONTROL.COM
Name Server: NS18.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/
>>> Last update of whois database: 2019-10-02T22:54:19Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.