edhenlyshukran.com

value of edhenlyshukran.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

edhenlyshukran.com was registered 4 years 8 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, edhenlyshukran.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 94 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
My blog – Just another WordPress site

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 6
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 13 Oct 2019 04:33:47 GMT
Server: Apache
X-Powered-By: PHP/7.2.20
Link: <http://edhenlyshukran.com/wp-json/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 3715
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-10-07 4 years 8 months 2 weeks ago
Last Modified: 2019-10-07 4 years 8 months 2 weeks ago
Expiration Date: 2020-10-07 3 years 8 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns07.domaincontrol.com 97.74.103.4 United States
ns08.domaincontrol.com 173.201.71.4 United States

DNS Record Analysis

Host Type TTL Extra
edhenlyshukran.com A 10796 IP: 43.255.154.9
edhenlyshukran.com NS 3600 Target: ns07.domaincontrol.com
edhenlyshukran.com NS 3600 Target: ns08.domaincontrol.com
edhenlyshukran.com SOA 596 MNAME: ns07.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019100701
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

Find the Best Real Estate Agents - Realtor Reviews, Home Sales and...

- referz.com

Real estate agent reviews and recommendations for the best realtor in your neighborhood. Free home valuation from a top realtor. Prepare to sell your home.

alexa 4,239,902  worth $240.00

Bridgeton Family Diner

- thebridgetonfamilydiner.com

Bridgeton's Finest Diner. We Have Great Tasting Food All Day Long!

alexa 13,891,296  worth $8.95

East Indian Recipes - Authentic East Indian Food Blog

- eastindianrecipes.net

Authentic East Indian Food Blog

alexa 19,241,122  worth $8.95

markets pay business – Just another WordPress site

- marketspaybusiness.info

alexa 17,958,072  worth $8.95

James + Park, social media for small businesses and personal brands.

- jamesandpark.com

James + Park is a digital marketing studio with a focus on social media marketing, influencer marketing, and Squarespace design. Born + bred in Detroit.

alexa 18,888,785  worth $8.95

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: EDHENLYSHUKRAN.COM
Registry Domain ID:
2441262858_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.godaddy.com
Registrar URL:
http://www.godaddy.com
Updated Date:
2019-10-07T21:13:17Z
Creation Date:
2019-10-07T21:13:16Z
Registry Expiry Date:
2020-10-07T21:13:16Z
Registrar: GoDaddy.com, LLC
Registrar
IANA ID: 146
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status:
clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server:
NS07.DOMAINCONTROL.COM
Name Server:
NS08.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-10-13T04:33:46Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.