dreamflyhigh.com

value of dreamflyhigh.com is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

dreamflyhigh.com was registered 4 years 9 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, dreamflyhigh.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 21,400
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 68 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
Dreamflyhigh – Fly High Towards Your Dream

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 5
H3 Headings: 3 H4 Headings: 3
H5 Headings: 5 H6 Headings: 2
Total IFRAMEs: Not Applicable Total Images: 12
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 06 Sep 2019 18:51:53 GMT
Server: Apache
X-Powered-By: PHP/7.2.19
Link: <http://dreamflyhigh.com/wp-json/>; rel="https://api.w.org/", <http://dreamflyhigh.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 12119
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: 2019-09-05 4 years 9 months 2 weeks ago
Last Modified: 2019-09-05 4 years 9 months 2 weeks ago
Expiration Date: 2020-09-05 3 years 9 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns43.domaincontrol.com 97.74.101.22 United States
ns44.domaincontrol.com 173.201.69.22 United States

DNS Record Analysis

Host Type TTL Extra
dreamflyhigh.com A 10798 IP: 43.255.154.9
dreamflyhigh.com NS 3600 Target: ns43.domaincontrol.com
dreamflyhigh.com NS 3600 Target: ns44.domaincontrol.com
dreamflyhigh.com SOA 598 MNAME: ns43.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019090500
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites

雅情会 | 首页

- yahui820.com

alexa 1,918,924  worth $480.00

HoldingTrusts.com domain is for sale | Buy with Epik.com

- holdingtrusts.com

HoldingTrusts.com - Make an Offer if you want to buy this domain. Your purchase is secured by Epik.

alexa 5,467,959  worth $240.00

Hasil Pertandingan Bola Terlengkap - Gilabola365

- gilabola365.com

Hasil Pertandingan Bola Terlengkap Dari Segala Liga, dari liga champions, inggris, italia, prancis, spanyol, dan liga indonesia ada di sini

alexa 7,785,197  worth $8.95

Countryouths

- countryouths.org

alexa 2,052,492  worth $240.00

VCoin Money - Ñòàáèëüíûé çàðàáîòîê áåç âëîæåíèé

- vcoin-money.online

Íàø ïðîåêò ýòî õîðîøàÿ âîçìîæíîñòü çàðàáîòàòü ïî 20% â äåíü îò èíâåñòèöèè. Ðåôåðàëüíàÿ ñèñòåìà 5%. Áîíóñû, ÷àò è êðóãëîñóòî÷íàÿ ñëóæáà ïîääåðæêè.

alexa 729,200  worth $960.00

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: DREAMFLYHIGH.COM
Registry Domain ID:
2430106419_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.godaddy.com
Registrar URL:
http://www.godaddy.com
Updated Date:
2019-09-05T06:27:10Z
Creation Date:
2019-09-05T06:27:09Z
Registry Expiry Date:
2020-09-05T06:27:09Z
Registrar: GoDaddy.com, LLC
Registrar
IANA ID: 146
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
480-624-2505
Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited
Domain Status:
clientRenewProhibited
https://icann.org/epp#clientRenewProhibited
Domain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Domain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited
Name Server:
NS43.DOMAINCONTROL.COM
Name Server:
NS44.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2019-09-06T18:52:07Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.