akwp.us

value of akwp.us is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

It is a domain having .us extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, akwp.us is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 57,500
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 100 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

43.255.154.9

Hosted Country:

SG

Location Latitude:

1.28967

Location Longitude:

103.85

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
403 Forbidden

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 43.255.154.9)

Coming Soon

- mouryatastyfoods.com

alexa Not Applicable   worth $8.95

gangainvestments – your dreams is our dreams

- gangainvestments.com

alexa Not Applicable   worth $8.95

Photo Editing Company | Professional Photo Editing Services, India, USA,...

- photoutlook.com

Photo Outlook provides best ecommerce photo editing services at affordable prices. We Offers banner design, image editing services, image manipulation, photo editing company and...

alexa Not Applicable   worth $8.95

Coming Soon

- swaminarayansatsangpravachan.com

alexa Not Applicable   worth $8.95

Coming Soon

- yudycambodia.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 23 Oct 2019 10:58:18 GMT
Server: Apache
Content-Length: 328
Connection: close
Content-Type: text/html; charset=iso-8859-1

Domain Information

Domain Registrar: NEUSTAR INC.

Domain Nameserver Information

Host IP Address Country
ns68.domaincontrol.com 173.201.71.44 United States
ns67.domaincontrol.com 97.74.103.44 United States

DNS Record Analysis

Host Type TTL Extra
akwp.us A 10800 IP: 43.255.154.9
akwp.us NS 3600 Target: ns68.domaincontrol.com
akwp.us NS 3600 Target: ns67.domaincontrol.com
akwp.us SOA 600 MNAME: ns67.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019101601
Refresh: 28800
Retry: 7200
Expire: 604800

Similarly Ranked Websites


rapidosTicket

- rapidosticket.com

alexa 17,860,384  worth $8.95

JAV Sex videos : Niche Specefic : English Subbed : Oh JAV

- ohjav.com

The spirits of filty Japanese Porn is calling you. Ohjav is here to compensate you in your dreams. Watch free sex videos & your favourite AV Idols.

alexa 8,109,660  worth $240.00

Drupal Association | Drupal.org

- association.drupal.org

The Drupal Association is dedicated to fostering and supporting the Drupal software project, the community and its growth. We help the Drupal community with funding,...

alexa 4,433  worth $3,757,320.00

MaGiao Instagram

- magiaoig.club

alexa 18,982,915  worth $8.95

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Number of allowed queries exceeded.

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.