Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2

Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2

Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2
Welcome Websites - Forastat

Welcome Websites


Katy Marcus & Dino Warden - Wedding Website - Wedding on 09/26/2020
- lifewiththewarden.com

Get all the wedding details for the Katy Marcus & Dino Warden wedding from their wedding website, including details for the wedding registry, travel, and hotels.

lifewiththewarden.com alexa Not Applicable   lifewiththewarden.com worth $ 8.95

Sarah Ameling & Philip Strauss - Wedding Website - Wedding on 06/13/2020
- philipandsarah2020.com

Get all the wedding details for the Sarah Ameling & Philip Strauss wedding from their wedding website, including details for the wedding registry, travel, and hotels.

philipandsarah2020.com alexa Not Applicable   philipandsarah2020.com worth $ 8.95

Holly Sullivan & David Williams - Wedding Website - Wedding on 05/30/2020
- daveandholly2020.com

Get all the wedding details for the Holly Sullivan & David Williams wedding from their wedding website, including details for the wedding registry, travel, and hotels.

daveandholly2020.com alexa Not Applicable   daveandholly2020.com worth $ 8.95

竞彩网
- 602906.com

大发云

602906.com alexa Not Applicable   602906.com worth $ 8.95

Allison Duer & Christopher McGee - Wedding Website - Wedding on 06/13/2020
- mcgeetingmarried.com

Get all the wedding details for the Allison Duer & Christopher McGee wedding from their wedding website, including details for the wedding registry, travel, and hotels.

mcgeetingmarried.com alexa Not Applicable   mcgeetingmarried.com worth $ 8.95

Jill Sargeant & Gordon Grajek - Wedding Website - Wedding on 07/25/2020
- jillandgordon2020.com

Get all the wedding details for the Jill Sargeant & Gordon Grajek wedding from their wedding website, including details for the wedding registry, travel, and hotels.

jillandgordon2020.com alexa Not Applicable   jillandgordon2020.com worth $ 8.95

Artistry-Lupe Del Toro
- deltoroartistry.com

deltoroartistry.com alexa Not Applicable   deltoroartistry.com worth $ 8.95

Ronnie and Shamir - Wedding Website - Wedding on 04/25/2020
- shamirandronald.com

Get all the wedding details for the Ronnie and Shamir wedding from their wedding website, including details for the wedding registry, travel, and hotels.

shamirandronald.com alexa Not Applicable   shamirandronald.com worth $ 8.95

Jeannie Gentile & Matthew Butrica - Wedding Website - Wedding on 07/03/2020
- becomingabutrica.com

Get all the wedding details for the Jeannie Gentile & Matthew Butrica wedding from their wedding website, including details for the wedding registry, travel, and hotels.

becomingabutrica.com alexa Not Applicable   becomingabutrica.com worth $ 8.95

Laura Young & Eric Abel - Wedding Website - Wedding on 05/30/2020
- lauraanderic0530.com

Get all the wedding details for the Laura Young & Eric Abel wedding from their wedding website, including details for the wedding registry, travel, and hotels.

lauraanderic0530.com alexa Not Applicable   lauraanderic0530.com worth $ 8.95

Welcome! - Ela and Cameron
- camandela.com

Welcome!: Please join us on April 18, 2020 in the celebration of our marriage at the Cedar Brae Golf and Country Club.

camandela.com alexa Not Applicable   camandela.com worth $ 8.95

Isabelle & Nima - Wedding Website - Wedding on 12/31/2019
- isabelle-and-nima-wedding.com

Get all the wedding details for the Isabelle & Nima wedding from their wedding website, including details for the wedding registry, travel, and hotels.

isabelle-and-nima-wedding.com alexa Not Applicable   isabelle-and-nima-wedding.com worth $ 8.95

Home | Dream Homes Realestate
- dreamhomesrealtykw.com

dreamhomesrealtykw.com alexa Not Applicable   dreamhomesrealtykw.com worth $ 8.95

Jennifer Wootton & Christina Johnson - Wedding Website - Wedding on 02/22/2020
- jennyjoinsjohnson.com

Get all the wedding details for the Jennifer Wootton & Christina Johnson wedding from their wedding website, including details for the wedding registry, travel, and hotels.

jennyjoinsjohnson.com alexa Not Applicable   jennyjoinsjohnson.com worth $ 8.95

Katelyn Bushey & Matthew Grone - Wedding Website - Wedding on 07/31/2020
- matthewandkatelyn.com

Get all the wedding details for the Katelyn Bushey & Matthew Grone wedding from their wedding website, including details for the wedding registry, travel, and hotels.

matthewandkatelyn.com alexa Not Applicable   matthewandkatelyn.com worth $ 8.95

Welcome - Justin Birchfield and Kayleigh-Ann Williams
- justinbirchfieldandkayleighannwilliams.com

Welcome: We are getting married! We’ve created this website as a helpful resource for all of the need-to-know details in the lead up to our special day. Here you will find...

justinbirchfieldandkayleighannwilliams.com alexa Not Applicable   justinbirchfieldandkayleighannwilliams.com worth $ 8.95

Welcome! - Holly and Al
- hollyandal.com

Welcome!: We're getting married! In anticipation of the big day, we have created this wedding website to keep you up-to-date on the details of our wedding and to share...

hollyandal.com alexa Not Applicable   hollyandal.com worth $ 8.95

Joanie and Jonathan - Wedding Website - Wedding on 10/10/2020
- jonandjoanie2020.com

Get all the wedding details for the Joanie and Jonathan wedding from their wedding website, including details for the wedding registry, travel, and hotels.

jonandjoanie2020.com alexa Not Applicable   jonandjoanie2020.com worth $ 8.95

James Selsor and Kathryn Hegedus - Wedding Website - Wedding on 01/18/2020
- jamesandkatforever.com

Get all the wedding details for the James Selsor and Kathryn Hegedus wedding from their wedding website, including details for the wedding registry, travel, and hotels.

jamesandkatforever.com alexa Not Applicable   jamesandkatforever.com worth $ 8.95

Home
- stylishchocobutt.com

Welcome to StylishChocobutt's online storeHaving used Etsy and other platforms over the years, I have chosen to create my own shop where I can control

stylishchocobutt.com alexa Not Applicable   stylishchocobutt.com worth $ 8.95

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.