Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2

Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2

Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2
Welcome - Justin Birchfield and Kayleigh-Ann Williams - justinbirchfieldandkayleighannwilliams.com - Forastat

justinbirchfieldandkayleighannwilliams.com

value of justinbirchfieldandkayleighannwilliams.com is about $8.95
Welcome: We are getting married! We’ve created this website as a helpful resource for all of the need-to-know details in the lead up to our special day. Here you will find directions to our venue, a few accomodation reccomendations and much more!
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

Welcome: We are getting married! We’ve created this website as a helpful resource for all of the need-to-know details in the lead up to our special day. Here you will find directions to our venue, a few accomodation reccomendations and much more! justinbirchfieldandkayleighannwilliams.com was registered 6 years 1 month ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, justinbirchfieldandkayleighannwilliams.com is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 473,000
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 83 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

213.27.154.202

Hosted Country:

ES

Location Latitude:

41.3888

Location Longitude:

2.15899

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable
Welcome - Justin Birchfield and Kayleigh-Ann Williams
Welcome: We are getting married! We’ve created this website as a helpful resource for all of the need-to-know details in the lead up to our special day. Here you will find directions to our venue, a few accomodation reccomendations and much more!

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 213.27.154.202)

Bienvenue ! - Nathalie & Matthieu

- sotail2019.com

Bienvenue !: Un mariage et un baptême! Après plus de 10 ans de vie commune et deux enfants, nous avons décidés nous marrier ! Comme nous souhaitions aussi donner un parrain et...

alexa Not Applicable   worth $8.95

¡Bienvenidos! - Aye y David

- ayedavid.com

¡Bienvenidos!: ¡Que sí! Que nos casamos!!!¡Estamos super felices! Nos sentimos en las nubes y queremos compartir contigo todo nuestro amor. Por eso estamos preparando una boda...

alexa Not Applicable   worth $8.95

Benvenuti! - Calci & Feig

- calciefeig.com

Benvenuti!: Grazie di essere qui! In questo sito potrete trovare tutte (...o quasi!!) le informazioni sul nostro matrimonio. Per qualsiasi necessità, informazione o...

alexa Not Applicable   worth $8.95

Welcome ! - Tatiana & Antoine

- tatitoinou.com

Welcome !: Hey - Salut - Привет ! We are excited to invite you to celebrate our love with us. You will find all the updates and useful information on this website. Stay tuned...

alexa Not Applicable   worth $8.95

Welcome! -

- benandsarahstipkala.com

Welcome!: We are getting married! We could not be more excited, and are looking forward to celebrating with you in the summer! We have created this website to keep you updated...

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 26 Oct 2019 12:03:46 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 50653
Connection: keep-alive
Server: Apache
Vary: User-Agent,Accept-Encoding
Cache-Control: no-cache, private
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
X-Frame-Options: ALLOW-FROM https://www.weddingwire.ca
Referrer-Policy: strict-origin-when-cross-origin
Content-Security-Policy: frame-ancestors 'self'
Cross-Origin-Window-Policy: Deny
Content-Encoding: gzip

Domain Information

Domain Registrar: EuroDNS S.A.
Registration Date: 2019-10-24 6 years 1 month 3 weeks ago
Last Modified: 2019-10-24 6 years 1 month 3 weeks ago
Expiration Date: 2020-10-24 5 years 1 month 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.eurodns.com 8.20.241.107 United States
ns2.eurodns.com 8.20.243.107 United States
ns3.eurodns.com 8.20.241.108 United States
ns4.eurodns.com 8.20.243.108 United States

DNS Record Analysis

Host Type TTL Extra
justinbirchfieldandkayleighannwilliams.com A 600 IP: 213.27.154.202
justinbirchfieldandkayleighannwilliams.com NS 86400 Target: ns4.eurodns.com
justinbirchfieldandkayleighannwilliams.com NS 86400 Target: ns1.eurodns.com
justinbirchfieldandkayleighannwilliams.com NS 86400 Target: ns2.eurodns.com
justinbirchfieldandkayleighannwilliams.com NS 86400 Target: ns3.eurodns.com
justinbirchfieldandkayleighannwilliams.com SOA 10800 MNAME: ns1.eurodns.com
RNAME: hostmaster.eurodns.com
Serial: 2019102401
Refresh: 43200
Retry: 7200
Expire: 1209600
justinbirchfieldandkayleighannwilliams.com MX 600 Priority: 10
Target: smtp3.nuptic.com
justinbirchfieldandkayleighannwilliams.com TXT 3600 TXT: {"idProject":"50"}


























Similarly Ranked Websites

My Blog - My WordPress Blog

- waterde.com

My WordPress Blog

alexa 9,762,782  worth $8.95

NXGT Hosting - Cheapest OffShore DMCA Ignored Hosting

- nxgthosting.com

NXGT Hosting is the most reliable hosting provider in Cheapest OffShore DMCA Ignored Hosting, Bullet Proof Servers (VPS, Dedicated) Managed & Unmanaged Servers.

alexa 330,103  worth $29,160.00


Landing Page London - Woman

- magnahomes.online

alexa 9,873,340  worth $8.95

Index of /

- beyouhc.com

alexa 13,897,532  worth $8.95

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name:
JUSTINBIRCHFIELDANDKAYLEIGHANNWILLIAMS.COM
Registry Domain ID:
2447161993_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.eurodns.com
Registrar URL:
http://www.EuroDNS.com
Updated Date:
2019-10-24T18:02:03Z
Creation Date:
2019-10-24T17:58:03Z
Registry Expiry Date:
2020-10-24T17:58:03Z
Registrar: EuroDNS S.A.
Registrar IANA
ID: 1052
Registrar Abuse Contact Email:
legal@eurodns.com
Registrar Abuse Contact Phone:
+352.27220150
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Name Server:
NS1.EURODNS.COM
Name Server: NS2.EURODNS.COM
Name Server:
NS3.EURODNS.COM
Name Server: NS4.EURODNS.COM
DNSSEC:
unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/
>>> Last update of whois database:
2019-10-26T12:03:57Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.