envision-the-future.net

value of envision-the-future.net is about $8.95
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Visit Website Update Report Abuse
1.67 Rating by

envision-the-future.net was registered 4 years 8 months ago. It is a domain having .net extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, envision-the-future.net is SAFE to browse.

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 11,100,000
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 100 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

206.188.192.183

Hosted Country:

US

Location Latitude:

30.1426

Location Longitude:

-81.5727

Page Resources Breakdown

preloader

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 206.188.192.183)

mylittlewheelsispinarechakras.com

- mylittlewheelsispinarechakras.com

alexa Not Applicable   worth $8.95

Deanandjean.com

- deanandjean.com

alexa Not Applicable   worth $8.95

Julieldolphin.com

- julieldolphin.com

alexa Not Applicable   worth $8.95

Phytomedhoney.global

- phytomedhoney.global

alexa Not Applicable   worth $8.95

Angryoutburststudy.com

- angryoutburststudy.com

alexa Not Applicable   worth $8.95

Backlink History Chart from Majestic SEO

backlinks discovery

Referring Domains Discovery Chart from Majestic SEO

referring domains

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty/1.13.6.2
Date: Thu, 19 Sep 2019 19:16:50 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.6.17-pl0-gentoo
X-Webcom-Cache-Status: BYPASS
Content-Encoding: gzip

Domain Information

Domain Registrar: Network Solutions, LLC
Registration Date: 2019-09-17 4 years 8 months 2 weeks ago
Last Modified: 2019-09-17 4 years 8 months 2 weeks ago
Expiration Date: 2020-09-17 3 years 8 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns89.worldnic.com 207.204.40.145 United States
ns90.worldnic.com 207.204.21.145 United States

DNS Record Analysis

Host Type TTL Extra
envision-the-future.net A 7199 IP: 206.188.192.183
envision-the-future.net NS 7200 Target: ns89.worldnic.com
envision-the-future.net NS 7200 Target: ns90.worldnic.com
envision-the-future.net SOA 3599 MNAME: ns89.worldnic.com
RNAME: namehost.worldnic.com
Serial: 119091715
Refresh: 10800
Retry: 3600
Expire: 604800

Similarly Ranked Websites

E-MarketingVN.com

- emarketingvn.com

alexa 9,194,267  worth $8.95

ssmapper.com - This website is for sale! - ssmapper...

- ssmapper.com

This website is for sale! ssmapper.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find...

alexa 15,407,891  worth $8.95

tour in morocco

- tour-inmorocco.com

Your visual guide in a world of nature, beauty, travel and adventure

alexa 9,011,861  worth $8.95

Account Suspended

- xciop.com

alexa 6,681,994  worth $8.95

Stra Cycler

- pscripto.com

alexa 8,415,226  worth $8.95

Alexa Traffic Rank

alexa traffic rank

Alexa Search Engine Traffic

alexa search traffic

Full WHOIS Lookup

Domain Name: ENVISION-THE-FUTURE.NET
Registry Domain ID:
2434440436_DOMAIN_NET-VRSN
Registrar WHOIS Server:
whois.networksolutions.com
Registrar URL:
http://networksolutions.com
Updated Date:
2019-09-17T19:04:19Z
Creation Date:
2019-09-17T19:01:08Z
Registry Expiry Date:
2020-09-17T19:01:08Z
Registrar: Network Solutions,
LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
+1.8003337680
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Name Server:
NS89.WORLDNIC.COM
Name Server: NS90.WORLDNIC.COM
DNSSEC:
unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/
>>> Last update of whois database:
2019-09-19T19:16:42Z

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.