Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2

Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2

Warning: date(): It is not safe to rely on the system's timezone settings. You are *required* to use the date.timezone setting or the date_default_timezone_set() function. In case you used any of those methods and you are still getting this warning, you most likely misspelled the timezone identifier. We selected the timezone 'UTC' for now, but please set date.timezone to select your timezone. in /home/forasta/public_html/index.php on line 2
Care Websites - Forastat

Care Websites


Senior Care | Bethesda Senior Care | United States
- bethesdaseniorcare.us

Welcome to one of the most unique Residential Care Facilities for the Elderly, Bethesda Senior Care. This home comes with many amazing features like call buttons, 24/7...

bethesdaseniorcare.us alexa Not Applicable   bethesdaseniorcare.us worth $ 8.95

Home | Jade's dog rescue
- jadesdogrescue.com

jadesdogrescue.com alexa Not Applicable   jadesdogrescue.com worth $ 8.95

Home | HOME @ LAST HEALTHCARE LLC
- homeatlasthealthcare.com

homeatlasthealthcare.com alexa Not Applicable   homeatlasthealthcare.com worth $ 8.95

Home | Honey Girl Skin Care
- honeygirlskincare.com

honeygirlskincare.com alexa Not Applicable   honeygirlskincare.com worth $ 8.95

Care | Support 4 Independence Ltd | Northampton | day service |
- s4i.org

Support 4 Independence Ltd, S4Iltd, Day Services, Supported Living, Community Support, Care, Street Dance all under one roof to support individuals with Acquired Brain Injury,...

s4i.org alexa Not Applicable   s4i.org worth $ 8.95

Pet Transport - Pet Care
- pet-relocation-nb.com

Pet Transport, Pet Sitting Services - Pet Transport Anywhere Worldwide; Local Pet Care; Private, Reliable & Safe; Military Pet Relocation

pet-relocation-nb.com alexa Not Applicable   pet-relocation-nb.com worth $ 8.95

Home | Amazing Creations By Lu
- amazingcreationsbylu.com

amazingcreationsbylu.com alexa Not Applicable   amazingcreationsbylu.com worth $ 8.95

Home | BUSINESS NAME
- caresupreme.net

caresupreme.net alexa Not Applicable   caresupreme.net worth $ 8.95

Home | Happy and Healthy kids
- happyhealthykidsfamilydaycare.com

happyhealthykidsfamilydaycare.com alexa Not Applicable   happyhealthykidsfamilydaycare.com worth $ 8.95

Home | Alice Boyd
- aliceboydcbt.com

aliceboydcbt.com alexa Not Applicable   aliceboydcbt.com worth $ 8.95

Home | The Rainbow Project Child and Family Counseling LLC
- rainbowchildtherapy.com

rainbowchildtherapy.com alexa Not Applicable   rainbowchildtherapy.com worth $ 8.95

Home | Ideallee Distributors
- idealleedistributors.com

idealleedistributors.com alexa Not Applicable   idealleedistributors.com worth $ 8.95

Home | Hannah Herkert Counseling Services
- hannahherkertcounseling.com

hannahherkertcounseling.com alexa Not Applicable   hannahherkertcounseling.com worth $ 8.95

Tamara Bransburg LCSW
- tamarabransburglcsw.com

Therapy for Adolescents and Adults in Oakland, California. Psychotherapy by Tamara Bransburg. Queer and Trans. People of Color. Individual Therapy.

tamarabransburglcsw.com alexa Not Applicable   tamarabransburglcsw.com worth $ 8.95

Boarding cattery | Moss Hall Farm Cattery | Bolton
- mosshallfarmcattery.com

We set up Moss Hall Farm Cattery in 2009 to provide an incredible experience for Cats and their owners. From small beginnings, we’ve added a whole range of services, making us...

mosshallfarmcattery.com alexa Not Applicable   mosshallfarmcattery.com worth $ 8.95

Hair Extensions | Mark Summers Hair Extensions | Morpeth
- marksummershair.com

Now Taking Bookings! Flawless Hair Extensions that last 6-12 months with no damage to your own hair! Book your consultation today.

marksummershair.com alexa Not Applicable   marksummershair.com worth $ 8.95

Healthcare | Home
- spirobiz.com

spirobiz.com alexa Not Applicable   spirobiz.com worth $ 8.95

ü50 fun
- xn--50-wka.fun

spaß und freizeit

xn--50-wka.fun alexa Not Applicable   xn--50-wka.fun worth $ 8.95

Home | Bumble Barbers
- bumblebarbers.com

bumblebarbers.com alexa Not Applicable   bumblebarbers.com worth $ 8.95

Celebrity Gossip & News | PopSugar Australia
- popsugar.com.au

We are an Addiction Recovery Public Advocacy Program which offers information and resources on substance abuse treatment, public policy, research, and prevention.

popsugar.com.au alexa 146,769   popsugar.com.au worth $ 46,800.00

ForaStat is a free tool which helps analyse websites and estimate valuation including such as Search Engine Reports, Traffic Reports, Social Engagement, Safety, Host Information, Domain WHOIS, Page Speed and much more.