woodlandechoes.on.ca

value of woodlandechoes.on.ca is about $8.95

7053873866 It is a domain having .on.ca extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, woodlandechoes.on.ca is SAFE to browse.


Daily Unique Visitors: Not Applicable

Daily Pageviews: Not Applicable

Income Per Day: $0.15

Estimated Worth: $8.95


Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 29,300
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 34 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

69.156.240.29

Hosted Country:

CA

Location Latitude:

43.686

Location Longitude:

-79.6087

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 3
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 69.156.240.29)

ELITE PERMITS INC - Home

Rating: 1.67 - elitepermitsinc.com

Elite Permits Inc

Alexa: Not Applicable
Worth: $8.95

Under Construction

Rating: 1.67 - 4312651.com

Alexa: Not Applicable
Worth: $8.95

Maude Forcier Home

Rating: 1.67 - maudeforcier.com

Maude Forcier

Alexa: Not Applicable
Worth: $8.95

XYZ. La revue de la nouvelle

Rating: 1.67 - xyzrevue.com

Alexa: 8,392,398
Worth: $240.00

Under Construction

Rating: 1.67 - acadiafinancialpaymentservices.com

Alexa: Not Applicable
Worth: $8.95

Backlink History Chart from Majestic SEO

Referring Domains Discovery Chart from Majestic SEO

Domain Information

Domain Registrar: CIRA

Domain Nameserver Information

Host IP Address Country
ns1.bellcanadahosting.com 69.156.240.254 Canada
ns2.bellcanadahosting.com 69.156.247.254 Canada
ns3.bellcanadahosting.com 64.29.158.254 United States

DNS Record Analysis

Host Type TTL Extra
woodlandechoes.on.ca A 10800 IP: 69.156.240.29
woodlandechoes.on.ca NS 86400 Target: ns3.bellcanadahosting.com
woodlandechoes.on.ca NS 86400 Target: ns1.bellcanadahosting.com
woodlandechoes.on.ca NS 86400 Target: ns2.bellcanadahosting.com
woodlandechoes.on.ca SOA 10799 MNAME: ns1.bellcanadahosting.com
RNAME: postmaster.bellcanadahosting.com
Serial: 1012
Refresh: 86400
Retry: 3600
Expire: 3600000
woodlandechoes.on.ca MX 86400 Priority: 100
Target: mx2c9.bellcanadahosting.com
woodlandechoes.on.ca MX 86400 Priority: 110
Target: mx3c9.bellcanadahosting.com
woodlandechoes.on.ca MX 86400 Priority: 10
Target: mx1c9.bellcanadahosting.com
woodlandechoes.on.ca TXT 86400 TXT: v=spf1 a
mxinclude:spfc9.megamailservers.cominclu
de:verticalresponse.com ~all

Similarly Ranked Websites

Index of /

Rating: 1.67 - vstorieslife.com

Alexa: 11,808,835
Worth: $8.95

403 Forbidden

Rating: 1.67 - otdihaysnami.com

Alexa: 16,667,817
Worth: $8.95

Time MasterPieces – Watches You'll Love to Have –...

Rating: 1.67 - timemasterpieces.com

Alexa: 5,675,326
Worth: $240.00

이터널 시티

Rating: 1.67 - eternalcity.hangame.com

Alexa: 36,165
Worth: $229,680.00

filepub.xyz

Rating: 1.67 - filepub.xyz

Alexa: 8,232,702
Worth: $8.95

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: woodlandechoes.on.caRegistry Domain ID:
D9423-CIRARegistrar WHOIS Server: whois.ca.fury.caRegistrar URL:
www.rebel.caUpdated Date: 2019-08-26T22:47:11ZCreation Date:
2000-10-30T09:03:30ZRegistry Expiry Date:
2019-12-14T05:00:00ZRegistrar: Rebel.ca Corp.Registrar IANA
ID:Registrar Abuse Contact Email:Registrar Abuse Contact Phone:Domain
Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedDomain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibitedRegistry Registrant ID:
21480272-CIRARegistrant Name: Echo Beach Cottage Resort incRegistrant
Organization:Registrant Street: 3 Woodland LaneRegistrant City:
MagnetawanRegistrant State/Province: ONRegistrant Postal Code:
P0A1P0Registrant Country: CARegistrant Phone: +1.7053873866Registrant
Phone Ext:Registrant Fax:Registrant Fax Ext:Registrant Email:
info@woodlandechoes.on.caRegistry Admin ID: 21577145-CIRAAdmin Name:
Roland St-DenisAdmin Organization: Echo Beach Cottage Resort incAdmin
Street: 3 Woodland LaneAdmin City: MagnetawanAdmin State/Province:
ONAdmin Postal Code: P0A1P0Admin Country: CAAdmin Phone:
+1.7053873866Admin Phone Ext:Admin Fax:Admin Fax Ext:Admin Email:
info@woodlandechoes.on.caRegistry Tech ID: 21577145-CIRATech Name:
Roland St-DenisTech Organization: Echo Beach Cottage Resort incTech
Street: 3 Woodland LaneTech City: MagnetawanTech State/Province:
ONTech Postal Code: P0A1P0Tech Country: CATech Phone:
+1.7053873866Tech Phone Ext:Tech Fax:Tech Fax Ext:Tech Email:
info@woodlandechoes.on.caRegistry Billing ID:Billing Name:Billing
Organization:Billing Street:Billing City:Billing
State/Province:Billing Postal Code:Billing Country:Billing
Phone:Billing Phone Ext:Billing Fax:Billing Fax Ext:Billing Email:Name
Server: ns1.bellcanadahosting.comName Server:
ns2.bellcanadahosting.comName Server: ns3.bellcanadahosting.comDNSSEC:
unsignedURL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/>>> Last update of WHOIS database:
2019-09-10T06:40:26Z