webconvert-ltd.com
value of webconvert-ltd.com is about $8.95
webconvert-ltd.com was registered 2 decades 5 years ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, webconvert-ltd.com is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $0.15 |
Estimated Worth: | $8.95 |
Search Engine Indexes
Google Indexed Pages: | 82 |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 49,500 |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | Not Applicable |
PageSpeed Score: | 69 ON 100 |
Domain Authority: | Not Applicable |
DMOZ Listing: | No |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Very Poor |
WOT Privacy: | Very Poor |
WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
69.156.240.29Hosted Country:
CALocation Latitude:
43.686Location Longitude:
-79.6087Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Google+: | Not Applicable |
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 1 |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 1 | Total Images: | 6 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 69.156.240.29)
ELITE PERMITS INC - Home
Rating: 1.67 - elitepermitsinc.com
Elite Permits Inc
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Under Construction
Rating: 1.67 - acadiafinancialpaymentservices.com
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 13 Sep 2019 01:00:04 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Status-Code: 200
Status: 200 OK
Date: Fri, 13 Sep 2019 01:00:04 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Registrar: | Tucows Domains Inc. |
---|---|
Registration Date: | 1998-09-11 2 decades 5 years 8 months ago |
Last Modified: | 2019-09-11 4 years 9 months 3 days ago |
Expiration Date: | 2022-09-10 1 year 9 months 17 hours ago |
Domain Nameserver Information
Host | IP Address | Country |
---|---|---|
ns1.bellhosting.com | 69.156.240.252 | Canada |
ns2.bellhosting.com | 69.156.247.252 | Canada |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
webconvert-ltd.com | A | 10799 |
IP: 69.156.240.29 |
webconvert-ltd.com | NS | 86400 |
Target: ns1.meganameservers.com |
webconvert-ltd.com | NS | 86400 |
Target: ns2.meganameservers.com |
webconvert-ltd.com | NS | 86400 |
Target: ns3.meganameservers.com |
webconvert-ltd.com | SOA | 10798 |
MNAME: ns1.meganameservers.com RNAME: postmaster.meganameservers.com Serial: 2006071717 Refresh: 86400 Retry: 3600 Expire: 3600000 |
webconvert-ltd.com | MX | 86400 |
Priority: 1 Target: mx1c9.megamailservers.com |
webconvert-ltd.com | MX | 86400 |
Priority: 10 Target: mx2c9.megamailservers.com |
webconvert-ltd.com | MX | 86400 |
Priority: 100 Target: mx3c9.megamailservers.com |
Similarly Ranked Websites
Chief Secretary for Administration | 政務司司長 | 政务司司长
Rating: 1.67 - cso.gov.hk
Alexa: 1,778,013
Worth: $480.00
Worth: $480.00
xo Stefania – Toronto Based VIP Companion
Rating: 1.67 - xostefania.nl
Alexa: 13,831,610
Worth: $8.95
Worth: $8.95
HugeDomains.com - Shop for over 300,000 Premium Domains
Rating: 1.67 - performiauk.com
Alexa: 14,093,852
Worth: $8.95
Worth: $8.95
Arts and Crafts - Hjem
Rating: 1.67 - ac.no
Arts & Crafts nettbutikk - Norges største smykke-brand. Stort utvalg designsmykker i høy kvalitet. Rask og trygg levering fra lager i Norge.
Alexa: 8,557,086
Worth: $8.95
Worth: $8.95
Alexa Traffic Rank
Alexa Search Engine Traffic
Full WHOIS Lookup
Domain Name: WEBCONVERT-LTD.COMRegistry Domain ID:
1952211_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.tucows.comRegistrar URL: http://www.tucows.comUpdated Date:
2019-09-11T13:41:38ZCreation Date: 1998-09-11T04:00:00ZRegistry Expiry
Date: 2022-09-10T04:00:00ZRegistrar: Tucows Domains Inc.Registrar IANA
ID: 69Registrar Abuse Contact Email:Registrar Abuse Contact
Phone:Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibitedDomain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedDomain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibitedName Server:
NS1.BELLHOSTING.COMName Server: NS2.BELLHOSTING.COMDNSSEC: unsignedURL
of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/>>> Last update of whois database:
2019-09-13T01:00:09Z
1952211_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.tucows.comRegistrar URL: http://www.tucows.comUpdated Date:
2019-09-11T13:41:38ZCreation Date: 1998-09-11T04:00:00ZRegistry Expiry
Date: 2022-09-10T04:00:00ZRegistrar: Tucows Domains Inc.Registrar IANA
ID: 69Registrar Abuse Contact Email:Registrar Abuse Contact
Phone:Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibitedDomain Status:
clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedDomain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibitedName Server:
NS1.BELLHOSTING.COMName Server: NS2.BELLHOSTING.COMDNSSEC: unsignedURL
of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/>>> Last update of whois database:
2019-09-13T01:00:09Z