wayneray.ca
value of wayneray.ca is about $8.95
It is a domain having .ca extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, wayneray.ca is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $0.15 |
Estimated Worth: | $8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 215,000 |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | Not Applicable |
PageSpeed Score: | 100 ON 100 |
Domain Authority: | Not Applicable |
DMOZ Listing: | No |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Very Poor |
WOT Privacy: | Very Poor |
WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
69.156.240.29Hosted Country:
CALocation Latitude:
43.686Location Longitude:
-79.6087Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Google+: | Not Applicable |
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 69.156.240.29)
ELITE PERMITS INC - Home
Rating: 1.67 - elitepermitsinc.com
Elite Permits Inc
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Under Construction
Rating: 1.67 - acadiafinancialpaymentservices.com
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 10 Sep 2019 08:49:35 GMT
Server: Apache
Content-Length: 44
Content-Type: text/html; charset=iso-8859-1
Status-Code: 200
Status: 200 OK
Date: Tue, 10 Sep 2019 08:49:35 GMT
Server: Apache
Content-Length: 44
Content-Type: text/html; charset=iso-8859-1
Domain Information
Domain Registrar: | CIRA |
---|
Domain Nameserver Information
Host | IP Address | Country |
---|---|---|
ns2.bellcanadahosting.com | 69.156.247.254 | Canada |
ns3.bellcanadahosting.com | 64.29.158.254 | United States |
ns1.bellcanadahosting.com | 69.156.240.254 | Canada |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
wayneray.ca | A | 10799 |
IP: 69.156.240.29 |
wayneray.ca | NS | 86400 |
Target: ns2.bellcanadahosting.com |
wayneray.ca | NS | 86400 |
Target: ns3.bellcanadahosting.com |
wayneray.ca | NS | 86400 |
Target: ns1.bellcanadahosting.com |
wayneray.ca | SOA | 10800 |
MNAME: ns1.bellcanadahosting.com RNAME: postmaster.bellcanadahosting.com Serial: 1012 Refresh: 86400 Retry: 3600 Expire: 3600000 |
wayneray.ca | MX | 86400 |
Priority: 10 Target: mx1c9.bellcanadahosting.com |
wayneray.ca | MX | 86400 |
Priority: 100 Target: mx2c9.bellcanadahosting.com |
wayneray.ca | MX | 86400 |
Priority: 110 Target: mx3c9.bellcanadahosting.com |
wayneray.ca | TXT | 86400 |
TXT: v=spf1 a mxinclude:spfc9.megamailservers.cominclu de:verticalresponse.com ~all |
Similarly Ranked Websites
Новинки фильмов 2019 онлайн в хорошем качестве HD
Rating: 1.67 - kinoxd.com
Фильмы онлайн в высоком качестве бесплатно
Alexa: 11,565,410
Worth: $8.95
Worth: $8.95
B90
Rating: 1.67 - roplj9lm.com
بزرگترین مرکز پیش بینی ورزشی و کازینو آنلاین
Alexa: 8,823,274
Worth: $8.95
Worth: $8.95
دانلود فیلم جدید | دانلود سریال
Rating: 1.67 - yoozdl.org
دانلود فیلم,دانلود فیلم جدید,دانلود رایگان فیلم,دانلود فیلم با لینک مستقیم,دانلود فیلم خارجی,دانلود فیلم ایرانی,دانلود سریال ایرانی,دانلود سریال خارجی
Alexa: 10,257,751
Worth: $8.95
Worth: $8.95
Alexa Traffic Rank
Alexa Search Engine Traffic
Full WHOIS Lookup
Domain Name: wayneray.caRegistry Domain ID: D306427-CIRARegistrar
WHOIS Server: whois.ca.fury.caRegistrar URL:
http://domainhelp.tucows.comUpdated Date: 2019-06-28T04:16:04ZCreation
Date: 2005-07-27T16:20:11ZRegistry Expiry Date:
2020-07-27T04:00:00ZRegistrar: Tucows.com Co.Registrar IANA
ID:Registrar Abuse Contact Email:Registrar Abuse Contact Phone:Domain
Status: ok https://icann.org/epp#OKRegistry Registrant ID: Redacted
for Privacy PurposesRegistrant Name: Redacted for Privacy
PurposesRegistrant Organization: Redacted for Privacy
PurposesRegistrant Street: Redacted for Privacy PurposesRegistrant
City: Redacted for Privacy PurposesRegistrant State/Province: Redacted
for Privacy PurposesRegistrant Postal Code: Redacted for Privacy
PurposesRegistrant Country: Redacted for Privacy PurposesRegistrant
Phone: Redacted for Privacy PurposesRegistrant Phone Ext: Redacted for
Privacy PurposesRegistrant Fax: Redacted for Privacy
PurposesRegistrant Fax Ext: Redacted for Privacy PurposesRegistrant
Email: Please ask the Registrar of Record identified in this output
for information on how to contact the Registrant, Admin, or Other
contacts of the queried domain nameRegistry Admin ID: Redacted for
Privacy PurposesAdmin Name: Redacted for Privacy PurposesAdmin
Organization: Redacted for Privacy PurposesAdmin Street: Redacted for
Privacy PurposesAdmin City: Redacted for Privacy PurposesAdmin
State/Province: Redacted for Privacy PurposesAdmin Postal Code:
Redacted for Privacy PurposesAdmin Country: Redacted for Privacy
PurposesAdmin Phone: Redacted for Privacy PurposesAdmin Phone Ext:
Redacted for Privacy PurposesAdmin Fax: Redacted for Privacy
PurposesAdmin Fax Ext: Redacted for Privacy PurposesAdmin Email:
Please ask the Registrar of Record identified in this output for
information on how to contact the Registrant, Admin, or Other contacts
of the queried domain nameRegistry Tech ID: Redacted for Privacy
PurposesTech Name: Redacted for Privacy PurposesTech Organization:
Redacted for Privacy PurposesTech Street: Redacted for Privacy
PurposesTech City: Redacted for Privacy PurposesTech State/Province:
Redacted for Privacy PurposesTech Postal Code: Redacted for Privacy
PurposesTech Country: Redacted for Privacy PurposesTech Phone:
Redacted for Privacy PurposesTech Phone Ext: Redacted for Privacy
PurposesTech Fax: Redacted for Privacy PurposesTech Fax Ext: Redacted
for Privacy PurposesTech Email: Please ask the Registrar of Record
identified in this output for information on how to contact the
Registrant, Admin, or Other contacts of the queried domain
nameRegistry Billing ID: Redacted for Privacy PurposesBilling Name:
Redacted for Privacy PurposesBilling Organization: Redacted for
Privacy PurposesBilling Street: Redacted for Privacy PurposesBilling
City: Redacted for Privacy PurposesBilling State/Province: Redacted
for Privacy PurposesBilling Postal Code: Redacted for Privacy
PurposesBilling Country: Redacted for Privacy PurposesBilling Phone:
Redacted for Privacy PurposesBilling Phone Ext: Redacted for Privacy
PurposesBilling Fax: Redacted for Privacy PurposesBilling Fax Ext:
Redacted for Privacy PurposesBilling Email: Please ask the Registrar
of Record identified in this output for information on how to contact
the Registrant, Admin, or Other contacts of the queried domain
nameName Server: ns1.bellcanadahosting.comName Server:
ns2.bellcanadahosting.comName Server: ns3.bellcanadahosting.comDNSSEC:
unsignedURL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/>>> Last update of WHOIS database:
2019-09-10T08:40:22Z
WHOIS Server: whois.ca.fury.caRegistrar URL:
http://domainhelp.tucows.comUpdated Date: 2019-06-28T04:16:04ZCreation
Date: 2005-07-27T16:20:11ZRegistry Expiry Date:
2020-07-27T04:00:00ZRegistrar: Tucows.com Co.Registrar IANA
ID:Registrar Abuse Contact Email:Registrar Abuse Contact Phone:Domain
Status: ok https://icann.org/epp#OKRegistry Registrant ID: Redacted
for Privacy PurposesRegistrant Name: Redacted for Privacy
PurposesRegistrant Organization: Redacted for Privacy
PurposesRegistrant Street: Redacted for Privacy PurposesRegistrant
City: Redacted for Privacy PurposesRegistrant State/Province: Redacted
for Privacy PurposesRegistrant Postal Code: Redacted for Privacy
PurposesRegistrant Country: Redacted for Privacy PurposesRegistrant
Phone: Redacted for Privacy PurposesRegistrant Phone Ext: Redacted for
Privacy PurposesRegistrant Fax: Redacted for Privacy
PurposesRegistrant Fax Ext: Redacted for Privacy PurposesRegistrant
Email: Please ask the Registrar of Record identified in this output
for information on how to contact the Registrant, Admin, or Other
contacts of the queried domain nameRegistry Admin ID: Redacted for
Privacy PurposesAdmin Name: Redacted for Privacy PurposesAdmin
Organization: Redacted for Privacy PurposesAdmin Street: Redacted for
Privacy PurposesAdmin City: Redacted for Privacy PurposesAdmin
State/Province: Redacted for Privacy PurposesAdmin Postal Code:
Redacted for Privacy PurposesAdmin Country: Redacted for Privacy
PurposesAdmin Phone: Redacted for Privacy PurposesAdmin Phone Ext:
Redacted for Privacy PurposesAdmin Fax: Redacted for Privacy
PurposesAdmin Fax Ext: Redacted for Privacy PurposesAdmin Email:
Please ask the Registrar of Record identified in this output for
information on how to contact the Registrant, Admin, or Other contacts
of the queried domain nameRegistry Tech ID: Redacted for Privacy
PurposesTech Name: Redacted for Privacy PurposesTech Organization:
Redacted for Privacy PurposesTech Street: Redacted for Privacy
PurposesTech City: Redacted for Privacy PurposesTech State/Province:
Redacted for Privacy PurposesTech Postal Code: Redacted for Privacy
PurposesTech Country: Redacted for Privacy PurposesTech Phone:
Redacted for Privacy PurposesTech Phone Ext: Redacted for Privacy
PurposesTech Fax: Redacted for Privacy PurposesTech Fax Ext: Redacted
for Privacy PurposesTech Email: Please ask the Registrar of Record
identified in this output for information on how to contact the
Registrant, Admin, or Other contacts of the queried domain
nameRegistry Billing ID: Redacted for Privacy PurposesBilling Name:
Redacted for Privacy PurposesBilling Organization: Redacted for
Privacy PurposesBilling Street: Redacted for Privacy PurposesBilling
City: Redacted for Privacy PurposesBilling State/Province: Redacted
for Privacy PurposesBilling Postal Code: Redacted for Privacy
PurposesBilling Country: Redacted for Privacy PurposesBilling Phone:
Redacted for Privacy PurposesBilling Phone Ext: Redacted for Privacy
PurposesBilling Fax: Redacted for Privacy PurposesBilling Fax Ext:
Redacted for Privacy PurposesBilling Email: Please ask the Registrar
of Record identified in this output for information on how to contact
the Registrant, Admin, or Other contacts of the queried domain
nameName Server: ns1.bellcanadahosting.comName Server:
ns2.bellcanadahosting.comName Server: ns3.bellcanadahosting.comDNSSEC:
unsignedURL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/>>> Last update of WHOIS database:
2019-09-10T08:40:22Z