wayneray.ca

value of wayneray.ca is about $8.95

It is a domain having .ca extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, wayneray.ca is SAFE to browse.


Daily Unique Visitors: Not Applicable

Daily Pageviews: Not Applicable

Income Per Day: $0.15

Estimated Worth: $8.95


Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 215,000
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 100 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

69.156.240.29

Hosted Country:

CA

Location Latitude:

43.686

Location Longitude:

-79.6087

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 69.156.240.29)

ELITE PERMITS INC - Home

Rating: 1.67 - elitepermitsinc.com

Elite Permits Inc

Alexa: Not Applicable
Worth: $8.95

Under Construction

Rating: 1.67 - 4312651.com

Alexa: Not Applicable
Worth: $8.95

Maude Forcier Home

Rating: 1.67 - maudeforcier.com

Maude Forcier

Alexa: Not Applicable
Worth: $8.95

XYZ. La revue de la nouvelle

Rating: 1.67 - xyzrevue.com

Alexa: 8,392,398
Worth: $240.00

Under Construction

Rating: 1.67 - acadiafinancialpaymentservices.com

Alexa: Not Applicable
Worth: $8.95

Backlink History Chart from Majestic SEO

Referring Domains Discovery Chart from Majestic SEO

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 10 Sep 2019 08:49:35 GMT
Server: Apache
Content-Length: 44
Content-Type: text/html; charset=iso-8859-1

Domain Information

Domain Registrar: CIRA

Domain Nameserver Information

Host IP Address Country
ns2.bellcanadahosting.com 69.156.247.254 Canada
ns3.bellcanadahosting.com 64.29.158.254 United States
ns1.bellcanadahosting.com 69.156.240.254 Canada

DNS Record Analysis

Host Type TTL Extra
wayneray.ca A 10799 IP: 69.156.240.29
wayneray.ca NS 86400 Target: ns2.bellcanadahosting.com
wayneray.ca NS 86400 Target: ns3.bellcanadahosting.com
wayneray.ca NS 86400 Target: ns1.bellcanadahosting.com
wayneray.ca SOA 10800 MNAME: ns1.bellcanadahosting.com
RNAME: postmaster.bellcanadahosting.com
Serial: 1012
Refresh: 86400
Retry: 3600
Expire: 3600000
wayneray.ca MX 86400 Priority: 10
Target: mx1c9.bellcanadahosting.com
wayneray.ca MX 86400 Priority: 100
Target: mx2c9.bellcanadahosting.com
wayneray.ca MX 86400 Priority: 110
Target: mx3c9.bellcanadahosting.com
wayneray.ca TXT 86400 TXT: v=spf1 a
mxinclude:spfc9.megamailservers.cominclu
de:verticalresponse.com ~all

Similarly Ranked Websites

Новинки фильмов 2019 онлайн в хорошем качестве HD

Rating: 1.67 - kinoxd.com

Фильмы онлайн в высоком качестве бесплатно

Alexa: 11,565,410
Worth: $8.95

gamekeysplus

Rating: 1.67 - gamekeysplus.com

Alexa: 6,020,220
Worth: $8.95

B90

Rating: 1.67 - roplj9lm.com

بزرگترین مرکز پیش بینی ورزشی و کازینو آنلاین

Alexa: 8,823,274
Worth: $8.95

دانلود فیلم جدید | دانلود سریال

Rating: 1.67 - yoozdl.org

دانلود فیلم,دانلود فیلم جدید,دانلود رایگان فیلم,دانلود فیلم با لینک مستقیم,دانلود فیلم خارجی,دانلود فیلم ایرانی,دانلود سریال ایرانی,دانلود سریال خارجی

Alexa: 10,257,751
Worth: $8.95

is not available

Rating: 1.67 - infopay.icu

Alexa: 10,950,033
Worth: $8.95

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: wayneray.caRegistry Domain ID: D306427-CIRARegistrar
WHOIS Server: whois.ca.fury.caRegistrar URL:
http://domainhelp.tucows.comUpdated Date: 2019-06-28T04:16:04ZCreation
Date: 2005-07-27T16:20:11ZRegistry Expiry Date:
2020-07-27T04:00:00ZRegistrar: Tucows.com Co.Registrar IANA
ID:Registrar Abuse Contact Email:Registrar Abuse Contact Phone:Domain
Status: ok https://icann.org/epp#OKRegistry Registrant ID: Redacted
for Privacy PurposesRegistrant Name: Redacted for Privacy
PurposesRegistrant Organization: Redacted for Privacy
PurposesRegistrant Street: Redacted for Privacy PurposesRegistrant
City: Redacted for Privacy PurposesRegistrant State/Province: Redacted
for Privacy PurposesRegistrant Postal Code: Redacted for Privacy
PurposesRegistrant Country: Redacted for Privacy PurposesRegistrant
Phone: Redacted for Privacy PurposesRegistrant Phone Ext: Redacted for
Privacy PurposesRegistrant Fax: Redacted for Privacy
PurposesRegistrant Fax Ext: Redacted for Privacy PurposesRegistrant
Email: Please ask the Registrar of Record identified in this output
for information on how to contact the Registrant, Admin, or Other
contacts of the queried domain nameRegistry Admin ID: Redacted for
Privacy PurposesAdmin Name: Redacted for Privacy PurposesAdmin
Organization: Redacted for Privacy PurposesAdmin Street: Redacted for
Privacy PurposesAdmin City: Redacted for Privacy PurposesAdmin
State/Province: Redacted for Privacy PurposesAdmin Postal Code:
Redacted for Privacy PurposesAdmin Country: Redacted for Privacy
PurposesAdmin Phone: Redacted for Privacy PurposesAdmin Phone Ext:
Redacted for Privacy PurposesAdmin Fax: Redacted for Privacy
PurposesAdmin Fax Ext: Redacted for Privacy PurposesAdmin Email:
Please ask the Registrar of Record identified in this output for
information on how to contact the Registrant, Admin, or Other contacts
of the queried domain nameRegistry Tech ID: Redacted for Privacy
PurposesTech Name: Redacted for Privacy PurposesTech Organization:
Redacted for Privacy PurposesTech Street: Redacted for Privacy
PurposesTech City: Redacted for Privacy PurposesTech State/Province:
Redacted for Privacy PurposesTech Postal Code: Redacted for Privacy
PurposesTech Country: Redacted for Privacy PurposesTech Phone:
Redacted for Privacy PurposesTech Phone Ext: Redacted for Privacy
PurposesTech Fax: Redacted for Privacy PurposesTech Fax Ext: Redacted
for Privacy PurposesTech Email: Please ask the Registrar of Record
identified in this output for information on how to contact the
Registrant, Admin, or Other contacts of the queried domain
nameRegistry Billing ID: Redacted for Privacy PurposesBilling Name:
Redacted for Privacy PurposesBilling Organization: Redacted for
Privacy PurposesBilling Street: Redacted for Privacy PurposesBilling
City: Redacted for Privacy PurposesBilling State/Province: Redacted
for Privacy PurposesBilling Postal Code: Redacted for Privacy
PurposesBilling Country: Redacted for Privacy PurposesBilling Phone:
Redacted for Privacy PurposesBilling Phone Ext: Redacted for Privacy
PurposesBilling Fax: Redacted for Privacy PurposesBilling Fax Ext:
Redacted for Privacy PurposesBilling Email: Please ask the Registrar
of Record identified in this output for information on how to contact
the Registrant, Admin, or Other contacts of the queried domain
nameName Server: ns1.bellcanadahosting.comName Server:
ns2.bellcanadahosting.comName Server: ns3.bellcanadahosting.comDNSSEC:
unsignedURL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/>>> Last update of WHOIS database:
2019-09-10T08:40:22Z