tyk-tyk.info
value of tyk-tyk.info is about $8.95
tyk-tyk.info was registered 6 years 1 month ago. It is a domain having .info extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, tyk-tyk.info is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $0.15 |
| Estimated Worth: | $8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| PageSpeed Score: | Not Applicable |
| Domain Authority: | Not Applicable |
| DMOZ Listing: | No |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Very Poor |
| WOT Privacy: | Very Poor |
| WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
104.28.23.33Hosted Country:
USLocation Latitude:
37.7757Location Longitude:
-122.395Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
| Google+: | Not Applicable |
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | 3 |
| H3 Headings: | 3 | H4 Headings: | Not Applicable |
| H5 Headings: | 2 | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.28.23.33)
Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100
Rating: 1.67 - centralpennsylvaniatrafficlawyers.com
Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
ã¬ã¼ã«ãºç§å¯ã®ãä»äºæ¢æ¤ -...
Rating: 1.67 - girls-girls.work
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Apache2 Ubuntu Default Page: It works
Rating: 1.67 - conceptpartssmart.club
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 520
Status: 520 Origin Error
Date: Sun, 09 Sep 2018 22:44:11 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 01 Jan 1970 00:00:01 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Server: cloudflare
CF-RAY: 457d2d9300a793a8-SJC
Status-Code: 520
Status: 520 Origin Error
Date: Sun, 09 Sep 2018 22:44:11 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 01 Jan 1970 00:00:01 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Server: cloudflare
CF-RAY: 457d2d9300a793a8-SJC
Domain Information
| Domain Registrar: | Afilias Global Registry Services |
|---|---|
| Registration Date: | 2018-08-09 6 years 1 month 3 weeks ago |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| tyk-tyk.info | A | 300 |
IP: 104.28.23.33 |
| tyk-tyk.info | A | 300 |
IP: 104.28.22.33 |
| tyk-tyk.info | NS | 86400 |
Target: tori.ns.cloudflare.com |
| tyk-tyk.info | NS | 86400 |
Target: theo.ns.cloudflare.com |
| tyk-tyk.info | SOA | 3600 |
MNAME: theo.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2028808205 Refresh: 10000 Retry: 2400 Expire: 604800 |
Similarly Ranked Websites
LTO Exam Reviewer | Free Driving Test Reviewer 2019
Rating: 1.67 - ltoexamreviewer.com
LTO Exam Reviewer provides the official LTO test questions with answers for aspiring drivers in the Philippines to pass the actual LTO written exam.
Alexa: 1,152,975
Worth: $720.00
Worth: $720.00
Alexa Traffic Rank
Alexa Search Engine Traffic
Full WHOIS Lookup
Domain Name: TYK-TYK.INFO
Registry Domain ID: D503300000129812499-LRMS
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: www.namecheap.com
Updated Date: 2018-09-08T11:51:05Z
Creation Date: 2018-09-08T11:48:53Z
Registry Expiry Date: 2019-09-08T11:48:53Z
Registrar Registration Expiration Date:
Registrar: NameCheap, Inc
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller:
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited Domain Status: serverTransferProhibited
https://icann.org/epp#serverTransferProhibited Domain Status: addPeriod https://icann.org/epp#addPeriod Registrant Organization: Registrant State/Province: Panama Registrant Country: PA Name Server: THEO.NS.CLOUDFLARE.COM Name Server: TORI.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form is
https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2018-09-09T22:43:13Z
https://icann.org/epp#clientTransferProhibited Domain Status: serverTransferProhibited
https://icann.org/epp#serverTransferProhibited Domain Status: addPeriod https://icann.org/epp#addPeriod Registrant Organization: Registrant State/Province: Panama Registrant Country: PA Name Server: THEO.NS.CLOUDFLARE.COM Name Server: TORI.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form is
https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2018-09-09T22:43:13Z