swaminarayansatsangpravachan.com
value of swaminarayansatsangpravachan.com is about $8.95
swaminarayansatsangpravachan.com was registered 1 decade 1 year ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, swaminarayansatsangpravachan.com is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $0.15 |
| Estimated Worth: | $8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | 208 |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| PageSpeed Score: | 100 ON 100 |
| Domain Authority: | Not Applicable |
| DMOZ Listing: | No |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Very Poor |
| WOT Privacy: | Very Poor |
| WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
43.255.154.9Hosted Country:
SGLocation Latitude:
1.28967Location Longitude:
103.85Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
| Google+: | Not Applicable |
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 43.255.154.9)
Let's plan the best bachelorette party in NYC
Rating: 1.67 - bestbachelorettenyc.com
This is better than those NYC Hotel Party rooms! Come stay overnight in the best bachelorette party loft, packages includes private pole dance party, aerial hoop party right...
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Cassia Clinic Physiotherapy Kolenchery
Rating: 1.67 - cassiaclinic.com
Cassia Physical Therapy will serve the residents of Ernakulam district and surrounding communities.The clinic is committed for 'Better Care and Better Living'.
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
SUPERANSHUMAN – HEALTH UNCOMPROMISED
Rating: 1.67 - superanshuman.com
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
Domain Information
| Domain Registrar: | PDR Ltd. d/b/a PublicDomainRegistry.com |
|---|---|
| Registration Date: | 2012-09-05 1 decade 1 year 8 months ago |
| Last Modified: | 2019-09-17 4 years 8 months 2 days ago |
| Expiration Date: | 2020-09-05 3 years 8 months 1 week ago |
Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| dns4.365webdns.com | 209.99.40.222 | United States |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| swaminarayansatsangpravachan.com | A | 10800 |
IP: 43.255.154.9 |
| swaminarayansatsangpravachan.com | NS | 38400 |
Target: dns2.365webdns.com |
| swaminarayansatsangpravachan.com | NS | 38400 |
Target: dns3.365webdns.com |
| swaminarayansatsangpravachan.com | NS | 38400 |
Target: dns4.365webdns.com |
| swaminarayansatsangpravachan.com | NS | 38400 |
Target: dns1.365webdns.com |
| swaminarayansatsangpravachan.com | SOA | 7200 |
MNAME: dns1.365webdns.com RNAME: tejaspatel_1986.yahoo.co.in Serial: 2019091701 Refresh: 7200 Retry: 7200 Expire: 172800 |
Similarly Ranked Websites
DRAWING PENCIL AND PAINTING - Best Drawing Arts Ideas with Pencil...
Rating: 1.67 - drawingpen99.com
DRAWING PENCIL AND PAINTING - Best Drawing Arts Ideas with Pencil and Paintings
Alexa: 1,521,846
Worth: $960.00
Worth: $960.00
Webmail | OVH- OVH
Rating: 1.67 - enquetedebiodiversite.com
Log in to Webmail
Alexa: 8,947,977
Worth: $240.00
Worth: $240.00
«Мед-Арт» медицинский центр - Диагностический центр...
Rating: 1.67 - med-art.center
Alexa: 11,225,347
Worth: $240.00
Worth: $240.00
WhenYourLife.com - Life Facts
Rating: 1.67 - whenyourlife.com
Amazing Life Facts
Alexa: 16,766,067
Worth: $8.95
Worth: $8.95
Alexa Traffic Rank
Alexa Search Engine Traffic
Full WHOIS Lookup
Domain Name: SWAMINARAYANSATSANGPRAVACHAN.COMRegistry Domain ID:
1742799543_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.PublicDomainRegistry.comRegistrar URL:
http://www.publicdomainregistry.comUpdated Date:
2019-09-17T18:55:49ZCreation Date: 2012-09-05T09:53:06ZRegistry Expiry
Date: 2020-09-05T09:53:06ZRegistrar: PDR Ltd. d/b/a
PublicDomainRegistry.comRegistrar IANA ID: 303Registrar Abuse Contact
Email: abuse-contact@publicdomainregistry.comRegistrar Abuse Contact
Phone: +1.2013775952Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedName Server:
DNS4.365WEBDNS.COMDNSSEC: unsignedURL of the ICANN Whois Inaccuracy
Complaint Form: https://www.icann.org/wicf/>>> Last update of whois
database: 2019-09-19T02:45:57Z
1742799543_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.PublicDomainRegistry.comRegistrar URL:
http://www.publicdomainregistry.comUpdated Date:
2019-09-17T18:55:49ZCreation Date: 2012-09-05T09:53:06ZRegistry Expiry
Date: 2020-09-05T09:53:06ZRegistrar: PDR Ltd. d/b/a
PublicDomainRegistry.comRegistrar IANA ID: 303Registrar Abuse Contact
Email: abuse-contact@publicdomainregistry.comRegistrar Abuse Contact
Phone: +1.2013775952Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedName Server:
DNS4.365WEBDNS.COMDNSSEC: unsignedURL of the ICANN Whois Inaccuracy
Complaint Form: https://www.icann.org/wicf/>>> Last update of whois
database: 2019-09-19T02:45:57Z