pcri.info

value of pcri.info is about $8.95

pcri.info was registered 6 years 1 month ago. It is a domain having .info extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, pcri.info is SAFE to browse.

Daily Unique Visitors: Not Applicable

Daily Pageviews: Not Applicable

Income Per Day: $0.15

Estimated Worth: $8.95

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 99 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

104.28.23.33

Hosted Country:

US

Location Latitude:

37.7757

Location Longitude:

-122.395

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.28.23.33)

Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

Rating: 1.67 - centralpennsylvaniatrafficlawyers.com

Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Alexa: Not Applicable
Worth: $8.95

tyk-tyk.info | 520: Web server is returning an unknown error

Rating: 1.67 - tyk-tyk.info

Alexa: Not Applicable
Worth: $8.95

ガールズ秘密のお仕事探検 -...

Rating: 1.67 - girls-girls.work

Alexa: Not Applicable
Worth: $8.95

Web Server's Default Page

Rating: 1.67 - qr.catering

Alexa: Not Applicable
Worth: $8.95

Apache2 Ubuntu Default Page: It works

Rating: 1.67 - conceptpartssmart.club

Alexa: Not Applicable
Worth: $8.95

Backlink History Chart from Majestic SEO

Referring Domains Discovery Chart from Majestic SEO

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Date: Wed, 05 Sep 2018 00:55:04 GMT
Content-Type: text/html; charset=iso-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Server: cloudflare
CF-RAY: 4554ba6834e46c76-SJC
Content-Encoding: gzip

Domain Information

Domain Registrar: Afilias Global Registry Services
Registration Date: 2018-08-31 6 years 1 month 21 hours ago

Domain Nameserver Information

Host IP Address Country
henry.ns.cloudflare.com 173.245.59.176 United States

DNS Record Analysis

Host Type TTL Extra
pcri.info A 299 IP: 104.28.22.33
pcri.info A 299 IP: 104.28.23.33
pcri.info NS 86400 Target: donna.ns.cloudflare.com
pcri.info NS 86400 Target: henry.ns.cloudflare.com
pcri.info SOA 3600 MNAME: donna.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2028773021
Refresh: 10000
Retry: 2400
Expire: 604800
pcri.info AAAA 300 IP: 2400:cb00:2048:1::681c:1721
pcri.info AAAA 300 IP: 2400:cb00:2048:1::681c:1621

Similarly Ranked Websites

Welcome to the APPUiO Documentation — APPUiO User Documentation 1.0...

Rating: 1.67 - docs.appuio.ch

Alexa: 12,352,847
Worth: $8.95

Skechers ultra flex first choice burgundy mesh / off white trim...

Rating: 1.67 - seprafs.com

Skechers ultra flex first choice burgundy mesh / off white trim TyoTcgFcOU

Alexa: 13,066,095
Worth: $8.95

Jatra Hotels and Resorts | It's a Boutique and 5 Star Luxury Hotels

Rating: 1.67 - jatrahotels.com

Jatra Hotels and Resorts official site. It owns and manages multi properties including boutique and 5 star hotels in Bali, Pekanbaru and Balikpapan.

Alexa: 2,738,331
Worth: $480.00

ETA YAZILIM.NET | Satış | Destek | 0 212 320 71 53

Rating: 1.67 - etayazilim.net

Eta Bilgisayar Programları Satış ve Destek hizmetleri.

Alexa: 19,644,146
Worth: $8.95

Aureate Labs: Your eCommerce Agency That Drives Revenue

Rating: 1.67 - aureatelabs.com

Aureate Labs provide complete eCommerce solutions for more visitors, conversions, & sales. Want to build a money-minting store? Get the most out of 15+ years of experience, NOW!

Alexa: 7,492,100
Worth: $240.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: PCRI.INFO Registry Domain ID: D503300000129695245-LRMS Registrar WHOIS Server: whois.reg.com Registrar URL: http://www.reg.com Updated Date: 2018-09-04T09:34:26Z Creation Date: 2018-08-31T10:45:15Z Registry Expiry Date: 2019-08-31T10:45:15Z Registrar Registration Expiration Date: Registrar: Limited Liability Company "Registrar of domain names
REG.RU" Registrar IANA ID: 1606 Registrar Abuse Contact Email: abuse@reg.ru Registrar Abuse Contact Phone: +7.4955801111 Reseller: Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited Domain Status: serverTransferProhibited
https://icann.org/epp#serverTransferProhibited Domain Status: addPeriod https://icann.org/epp#addPeriod Registrant Organization: Privacy Protection Registrant State/Province: Registrant Country: RU Name Server: HENRY.NS.CLOUDFLARE.COM Name Server: DONNA.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form is
https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2018-09-05T00:54:05Z