jvsportspicks.com

value of jvsportspicks.com is about $8.95

jvsportspicks.com was registered 4 years 8 months ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, jvsportspicks.com is SAFE to browse.


Daily Unique Visitors: Not Applicable

Daily Pageviews: Not Applicable

Income Per Day: $0.15

Estimated Worth: $8.95


Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 98
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 85 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

69.156.240.29

Hosted Country:

CA

Location Latitude:

43.686

Location Longitude:

-79.6087

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 2
H3 Headings: 6 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 6
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 69.156.240.29)

ELITE PERMITS INC - Home

Rating: 1.67 - elitepermitsinc.com

Elite Permits Inc

Alexa: Not Applicable
Worth: $8.95

Under Construction

Rating: 1.67 - 4312651.com

Alexa: Not Applicable
Worth: $8.95

Maude Forcier Home

Rating: 1.67 - maudeforcier.com

Maude Forcier

Alexa: Not Applicable
Worth: $8.95

XYZ. La revue de la nouvelle

Rating: 1.67 - xyzrevue.com

Alexa: 8,392,398
Worth: $240.00

Under Construction

Rating: 1.67 - acadiafinancialpaymentservices.com

Alexa: Not Applicable
Worth: $8.95

Backlink History Chart from Majestic SEO

Referring Domains Discovery Chart from Majestic SEO

Domain Information

Domain Registrar: Tucows Domains Inc.
Registration Date: 2019-09-03 4 years 8 months 3 weeks ago
Last Modified: 2019-09-03 4 years 8 months 3 weeks ago
Expiration Date: 2020-09-03 3 years 8 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bellcanadahosting.com 69.156.240.254 Canada
ns2.bellcanadahosting.com 69.156.247.254 Canada
ns3.bellcanadahosting.com 64.29.158.254 United States

DNS Record Analysis

Host Type TTL Extra
jvsportspicks.com A 10800 IP: 69.156.240.29
jvsportspicks.com NS 86400 Target: ns2.bellcanadahosting.com
jvsportspicks.com NS 86400 Target: ns3.bellcanadahosting.com
jvsportspicks.com NS 86400 Target: ns1.bellcanadahosting.com
jvsportspicks.com SOA 10800 MNAME: ns1.bellcanadahosting.com
RNAME: postmaster.bellcanadahosting.com
Serial: 1012
Refresh: 86400
Retry: 3600
Expire: 3600000
jvsportspicks.com MX 86400 Priority: 10
Target: mx1c9.bellcanadahosting.com
jvsportspicks.com MX 86400 Priority: 100
Target: mx2c9.bellcanadahosting.com
jvsportspicks.com MX 86400 Priority: 110
Target: mx3c9.bellcanadahosting.com
jvsportspicks.com TXT 86400 TXT: v=spf1 a
mxinclude:spfc9.megamailservers.cominclu
de:verticalresponse.com ~all

Similarly Ranked Websites

The Ultimate Amazon Seller Course | The Ultimate eCommerce University

Rating: 1.67 - ultimate-amazon-seller.teachable.com

The Ultimate Amazon FBA Course The Best Rated FBA Course

Alexa: 1,116
Worth: $7,915,320.00

Lashed BeautyCo — Secure

Rating: 1.67 - lashedbeautyco.com

Alexa: 15,007,601
Worth: $8.95


Iris Piercing Studio - Jewelry Gallery | Highest Quality Body...

Rating: 1.67 - irispiercing.com

Iris Piercing Studio offers you a modern and safe experience without compromise. We provide only the highest quality body jewelry and clean technique.

Alexa: 1,015,800
Worth: $720.00

ОТДЕЛЕНИЕ ВОЗВРАТОВ

Rating: 1.67 - pays-sb.online

Alexa: 3,267,230
Worth: $240.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: JVSPORTSPICKS.COMRegistry Domain ID:
2429747206_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.tucows.comRegistrar URL: http://www.tucows.comUpdated Date:
2019-09-03T19:06:57ZCreation Date: 2019-09-03T19:06:57ZRegistry Expiry
Date: 2020-09-03T19:06:57ZRegistrar: Tucows Domains Inc.Registrar IANA
ID: 69Registrar Abuse Contact Email:Registrar Abuse Contact
Phone:Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedDomain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibitedName Server:
NS1.BELLCANADAHOSTING.COMName Server: NS2.BELLCANADAHOSTING.COMName
Server: NS3.BELLCANADAHOSTING.COMDNSSEC: unsignedURL of the ICANN
Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/>>> Last
update of whois database: 2019-09-05T11:59:21Z