justinbirchfieldandkayleighannwilliams.com
value of justinbirchfieldandkayleighannwilliams.com is about $8.95
Welcome: We are getting married! We’ve created this website as a helpful resource for all of the need-to-know details in the lead up to our special day. Here you will find directions to our venue, a few accomodation reccomendations and much more! justinbirchfieldandkayleighannwilliams.com was registered 6 years 1 month ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, justinbirchfieldandkayleighannwilliams.com is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $0.15 |
| Estimated Worth: | $8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | 473,000 |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| PageSpeed Score: | 83 ON 100 |
| Domain Authority: | Not Applicable |
| DMOZ Listing: | No |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Very Poor |
| WOT Privacy: | Very Poor |
| WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
213.27.154.202Hosted Country:
ESLocation Latitude:
41.3888Location Longitude:
2.15899Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
| Google+: | Not Applicable |
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 1 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 213.27.154.202)
El Evento del Año - Sergio y Edgar
El Evento del Año: Buenas Señor@s nos Casamos Que algunos pensabais que nunca pasaríamos por el altar, bueno para que negarlo, los que nos conocéis sabéis que somos unas...
Worth: $8.95
Confermate la vostra presenza - Daria e Sergio
Confermate la vostra presenza: La cerimonia verrà celebrata nella Chiesa di San Francesco di Paola il 21 Settembre 2019 alle ore 11. A seguire, il ricevimento si terrà nella...
Worth: $8.95
Welcome! - Joel and Shyanne
Welcome!: We are getting married! We are on cloud nine and want to share our excitement with you. In anticipation of the big day, we have created this website to keep you...
Worth: $8.95
Bem-vindos! - Narayane e Israel
Bem-vindos!: Sim, é verdade! A gente vai se casar!!! Estamos muito felizes e queremos compartilhar com você todo o nosso amor. Por isso estamos preparando um casamento que fará...
Worth: $8.95
Welcome! - Rebecca and Jordan
Welcome!: We are getting married! We are on cloud nine and we want to share our excitement with you. In anticipation of the big day, we have created this wedding website to keep...
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
Date: Sat, 26 Oct 2019 12:03:46 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 50653
Connection: keep-alive
Server: Apache
Vary: User-Agent,Accept-Encoding
Cache-Control: no-cache, private
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
X-Frame-Options: ALLOW-FROM https://www.weddingwire.ca
Referrer-Policy: strict-origin-when-cross-origin
Content-Security-Policy: frame-ancestors 'self'
Cross-Origin-Window-Policy: Deny
Content-Encoding: gzip
Domain Information
| Domain Registrar: | EuroDNS S.A. |
|---|---|
| Registration Date: | 2019-10-24 6 years 1 month 3 weeks ago |
| Last Modified: | 2019-10-24 6 years 1 month 3 weeks ago |
| Expiration Date: | 2020-10-24 5 years 1 month 3 weeks ago |
Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns1.eurodns.com | 8.20.241.107 | United States |
| ns2.eurodns.com | 8.20.243.107 | United States |
| ns3.eurodns.com | 8.20.241.108 | United States |
| ns4.eurodns.com | 8.20.243.108 | United States |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| justinbirchfieldandkayleighannwilliams.com | A | 600 |
IP: 213.27.154.202 |
| justinbirchfieldandkayleighannwilliams.com | NS | 86400 |
Target: ns4.eurodns.com |
| justinbirchfieldandkayleighannwilliams.com | NS | 86400 |
Target: ns1.eurodns.com |
| justinbirchfieldandkayleighannwilliams.com | NS | 86400 |
Target: ns2.eurodns.com |
| justinbirchfieldandkayleighannwilliams.com | NS | 86400 |
Target: ns3.eurodns.com |
| justinbirchfieldandkayleighannwilliams.com | SOA | 10800 |
MNAME: ns1.eurodns.com RNAME: hostmaster.eurodns.com Serial: 2019102401 Refresh: 43200 Retry: 7200 Expire: 1209600 |
| justinbirchfieldandkayleighannwilliams.com | MX | 600 |
Priority: 10 Target: smtp3.nuptic.com |
| justinbirchfieldandkayleighannwilliams.com | TXT | 3600 |
TXT: {"idProject":"50"} |
Similarly Ranked Websites
slowex.com - slowex Resources and Information.
slowex.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, slowex.com has it all....
Worth: $240.00
Dice Age Games - Games & Hobby Shop - Vancouver, WA
Dice Age Games is a game and hobby shop in Vancouver, WA offering a large dedicated gaming area for war games, board games, and more!
Worth: $240.00
My-Dear Music
Free Mp3 Download , Lyric Chord Guitar , Free Ringtone Download , and Get Hiqh Qualtiy audio from Amazon , Spotify , Deezer , Itunes , Google Play , Youtube , Soundcloud and...
Worth: $240.00
Alexa Traffic Rank
Alexa Search Engine Traffic
Full WHOIS Lookup
ID: 2447161993_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.eurodns.comRegistrar URL: http://www.EuroDNS.comUpdated Date:
2019-10-24T18:02:03ZCreation Date: 2019-10-24T17:58:03ZRegistry Expiry
Date: 2020-10-24T17:58:03ZRegistrar: EuroDNS S.A.Registrar IANA ID:
1052Registrar Abuse Contact Email: legal@eurodns.comRegistrar Abuse
Contact Phone: +352.27220150Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedName Server:
NS1.EURODNS.COMName Server: NS2.EURODNS.COMName Server:
NS3.EURODNS.COMName Server: NS4.EURODNS.COMDNSSEC: unsignedURL of the
ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/>>>
Last update of whois database: 2019-10-26T12:03:57Z