justinbirchfieldandkayleighannwilliams.com

value of justinbirchfieldandkayleighannwilliams.com is about $8.95

Welcome: We are getting married! We’ve created this website as a helpful resource for all of the need-to-know details in the lead up to our special day. Here you will find directions to our venue, a few accomodation reccomendations and much more! justinbirchfieldandkayleighannwilliams.com was registered 6 years 1 month ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, justinbirchfieldandkayleighannwilliams.com is SAFE to browse.


Daily Unique Visitors: Not Applicable

Daily Pageviews: Not Applicable

Income Per Day: $0.15

Estimated Worth: $8.95


Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 473,000
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 83 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

213.27.154.202

Hosted Country:

ES

Location Latitude:

41.3888

Location Longitude:

2.15899

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 213.27.154.202)

El Evento del Año - Sergio y Edgar

Rating: 1.67 - sergioyedgar.com

El Evento del Año: Buenas Señor@s nos Casamos Que algunos pensabais que nunca pasaríamos por el altar, bueno para que negarlo, los que nos conocéis sabéis que somos unas...

Alexa: Not Applicable
Worth: $8.95

Confermate la vostra presenza - Daria e Sergio

Rating: 1.67 - dariasergio.com

Confermate la vostra presenza: La cerimonia verrà celebrata nella Chiesa di San Francesco di Paola il 21 Settembre 2019 alle ore 11. A seguire, il ricevimento si terrà nella...

Alexa: Not Applicable
Worth: $8.95

Welcome! - Joel and Shyanne

Rating: 1.67 - theknoopsnyswedding.com

Welcome!: We are getting married! We are on cloud nine and want to share our excitement with you. In anticipation of the big day, we have created this website to keep you...

Alexa: Not Applicable
Worth: $8.95

Bem-vindos! - Narayane e Israel

Rating: 1.67 - narayaneeisrael.com

Bem-vindos!: Sim, é verdade! A gente vai se casar!!! Estamos muito felizes e queremos compartilhar com você todo o nosso amor. Por isso estamos preparando um casamento que fará...

Alexa: Not Applicable
Worth: $8.95

Welcome! - Rebecca and Jordan

Rating: 1.67 - jordanandrebeccahalifax2020.com

Welcome!: We are getting married! We are on cloud nine and we want to share our excitement with you. In anticipation of the big day, we have created this wedding website to keep...

Alexa: Not Applicable
Worth: $8.95

Backlink History Chart from Majestic SEO

Referring Domains Discovery Chart from Majestic SEO

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 26 Oct 2019 12:03:46 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 50653
Connection: keep-alive
Server: Apache
Vary: User-Agent,Accept-Encoding
Cache-Control: no-cache, private
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
X-Frame-Options: ALLOW-FROM https://www.weddingwire.ca
Referrer-Policy: strict-origin-when-cross-origin
Content-Security-Policy: frame-ancestors 'self'
Cross-Origin-Window-Policy: Deny
Content-Encoding: gzip

Domain Information

Domain Registrar: EuroDNS S.A.
Registration Date: 2019-10-24 6 years 1 month 3 weeks ago
Last Modified: 2019-10-24 6 years 1 month 3 weeks ago
Expiration Date: 2020-10-24 5 years 1 month 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.eurodns.com 8.20.241.107 United States
ns2.eurodns.com 8.20.243.107 United States
ns3.eurodns.com 8.20.241.108 United States
ns4.eurodns.com 8.20.243.108 United States

DNS Record Analysis

Host Type TTL Extra
justinbirchfieldandkayleighannwilliams.com A 600 IP: 213.27.154.202
justinbirchfieldandkayleighannwilliams.com NS 86400 Target: ns4.eurodns.com
justinbirchfieldandkayleighannwilliams.com NS 86400 Target: ns1.eurodns.com
justinbirchfieldandkayleighannwilliams.com NS 86400 Target: ns2.eurodns.com
justinbirchfieldandkayleighannwilliams.com NS 86400 Target: ns3.eurodns.com
justinbirchfieldandkayleighannwilliams.com SOA 10800 MNAME: ns1.eurodns.com
RNAME: hostmaster.eurodns.com
Serial: 2019102401
Refresh: 43200
Retry: 7200
Expire: 1209600
justinbirchfieldandkayleighannwilliams.com MX 600 Priority: 10
Target: smtp3.nuptic.com
justinbirchfieldandkayleighannwilliams.com TXT 3600 TXT: {"idProject":"50"}


























Similarly Ranked Websites

slowex.com - slowex Resources and Information.

Rating: 1.67 - slowex.com

slowex.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, slowex.com has it all....

Alexa: 9,423,974
Worth: $240.00

Dice Age Games - Games & Hobby Shop - Vancouver, WA

Rating: 1.67 - diceagegames.com

Dice Age Games is a game and hobby shop in Vancouver, WA offering a large dedicated gaming area for war games, board games, and more!

Alexa: 7,056,038
Worth: $240.00

seao2.org website

Rating: 1.67 - seao2.info

Homepage

Alexa: 11,185,735
Worth: $240.00

HOPE Church | Find HOPE. Experience God.

Rating: 1.67 - gfhope.org

Alexa: 4,586,981
Worth: $240.00

My-Dear Music

Rating: 1.67 - my-dear-music.com

Free Mp3 Download , Lyric Chord Guitar , Free Ringtone Download , and Get Hiqh Qualtiy audio from Amazon , Spotify , Deezer , Itunes , Google Play , Youtube , Soundcloud and...

Alexa: 5,997,568
Worth: $240.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: JUSTINBIRCHFIELDANDKAYLEIGHANNWILLIAMS.COMRegistry Domain
ID: 2447161993_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.eurodns.comRegistrar URL: http://www.EuroDNS.comUpdated Date:
2019-10-24T18:02:03ZCreation Date: 2019-10-24T17:58:03ZRegistry Expiry
Date: 2020-10-24T17:58:03ZRegistrar: EuroDNS S.A.Registrar IANA ID:
1052Registrar Abuse Contact Email: legal@eurodns.comRegistrar Abuse
Contact Phone: +352.27220150Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedName Server:
NS1.EURODNS.COMName Server: NS2.EURODNS.COMName Server:
NS3.EURODNS.COMName Server: NS4.EURODNS.COMDNSSEC: unsignedURL of the
ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/>>>
Last update of whois database: 2019-10-26T12:03:57Z