ferrtech.com

value of ferrtech.com is about $8.95

ferrtech.com was registered 2 decades 4 years ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, ferrtech.com is SAFE to browse.


Daily Unique Visitors: Not Applicable

Daily Pageviews: Not Applicable

Income Per Day: $0.15

Estimated Worth: $8.95


Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $0.15
Estimated Worth: $8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 51,900
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 89 ON 100
Domain Authority: Not Applicable
DMOZ Listing: No

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Web Server Information

Hosted IP Address:

69.156.240.29

Hosted Country:

CA

Location Latitude:

43.686

Location Longitude:

-79.6087

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 10
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 69.156.240.29)

ELITE PERMITS INC - Home

Rating: 1.67 - elitepermitsinc.com

Elite Permits Inc

Alexa: Not Applicable
Worth: $8.95

Under Construction

Rating: 1.67 - 4312651.com

Alexa: Not Applicable
Worth: $8.95

Maude Forcier Home

Rating: 1.67 - maudeforcier.com

Maude Forcier

Alexa: Not Applicable
Worth: $8.95

XYZ. La revue de la nouvelle

Rating: 1.67 - xyzrevue.com

Alexa: 8,392,398
Worth: $240.00

Under Construction

Rating: 1.67 - acadiafinancialpaymentservices.com

Alexa: Not Applicable
Worth: $8.95

Backlink History Chart from Majestic SEO

Referring Domains Discovery Chart from Majestic SEO

Domain Information

Domain Registrar: Tucows Domains Inc.
Registration Date: 1999-10-05 2 decades 4 years 7 months ago
Last Modified: 2019-10-07 4 years 7 months 2 weeks ago
Expiration Date: 2022-10-05 1 year 7 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bellcanadahosting.com 69.156.240.254 Canada
ns2.bellcanadahosting.com 69.156.247.254 Canada
ns3.bellcanadahosting.com 64.29.158.254 United States

DNS Record Analysis

Host Type TTL Extra
ferrtech.com A 10799 IP: 69.156.240.29
ferrtech.com NS 86400 Target: ns3.bellcanadahosting.com
ferrtech.com NS 86400 Target: ns1.bellcanadahosting.com
ferrtech.com NS 86400 Target: ns2.bellcanadahosting.com
ferrtech.com SOA 10800 MNAME: ns1.bellcanadahosting.com
RNAME: postmaster.bellcanadahosting.com
Serial: 1012
Refresh: 86400
Retry: 3600
Expire: 3600000
ferrtech.com MX 86400 Priority: 100
Target: mx2c9.bellcanadahosting.com
ferrtech.com MX 86400 Priority: 110
Target: mx3c9.bellcanadahosting.com
ferrtech.com MX 86400 Priority: 10
Target: mx1c9.bellcanadahosting.com
ferrtech.com TXT 86400 TXT: v=spf1 a
mxinclude:spfc9.megamailservers.cominclu
de:verticalresponse.com ~all



























Similarly Ranked Websites

Addinfi Digitech | Top Digital Marketing Agency In Nagpur.

Rating: 1.67 - addinfi.com

Addinfi is a top digital marketing agency in Nagpur that provides services like social media marketing, email marketing and more across India and abroad.

Alexa: 3,988,786
Worth: $240.00

HOME | fmbfunrentals

Rating: 1.67 - funrentalsfmb.com

Alexa: 6,817,113
Worth: $240.00

Tienda Amazon (2018) AQUI OFERTAS de 50% o MAS!

Rating: 1.67 - descuentos-ofertas-cupones.com

Encuentra una gran variedad en las TIENDA AMAZON, un poco de todo, para el gusto exigente - Nuestro sitio web se actualiza todos los días.

Alexa: 1,830,080
Worth: $720.00

FinoFilipino - Humor, memes, gif, videos, fotos. - Web de...

Rating: 1.67 - finofilipino.org

Web de entretenimiento con la mejor selección de vídeos, memes, imágenes, y gifs de Internet. 1 post cada media hora de 7am a 1am

Alexa: 7,411
Worth: $2,247,480.00

DỰ ĐOÁN XSMB , SOI CẦU XSMB , TIN MẬT 3 CÀNG – SOI CẦU VIỆT – SOI...

Rating: 1.67 - tinmat3cang.com

Alexa: 9,124,603
Worth: $240.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: FERRTECH.COM Registry Domain ID: 11004693_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.tucows.com Registrar URL: http://www.tucows.com Updated Date: 2019-10-07T18:15:41Z Creation Date: 1999-10-05T18:58:29Z Registry Expiry Date: 2022-10-05T18:58:29Z Registrar: Tucows Domains Inc. Registrar IANA ID: 69 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: Domain Status: ok https://icann.org/epp#ok Name Server: NS1.BELLCANADAHOSTING.COM Name Server: NS2.BELLCANADAHOSTING.COM Name Server: NS3.BELLCANADAHOSTING.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/ >>> Last update of whois database: 2019-10-10T11:51:30Z