fectechnologie.com
value of fectechnologie.com is about $8.95
fectechnologie.com was registered 1 decade 5 years ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, fectechnologie.com is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $0.15 |
| Estimated Worth: | $8.95 |
Search Engine Indexes
| Google Indexed Pages: | 12 |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | 286 |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| PageSpeed Score: | 58 ON 100 |
| Domain Authority: | Not Applicable |
| DMOZ Listing: | No |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Very Poor |
| WOT Privacy: | Very Poor |
| WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
69.156.240.29Hosted Country:
CALocation Latitude:
43.686Location Longitude:
-79.6087Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
| Google+: | Not Applicable |
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | 6 |
| H3 Headings: | Not Applicable | H4 Headings: | 6 |
| H5 Headings: | 1 | H6 Headings: | 6 |
| Total IFRAMEs: | Not Applicable | Total Images: | 20 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 69.156.240.29)
ELITE PERMITS INC - Home
Rating: 1.67 - elitepermitsinc.com
Elite Permits Inc
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Under Construction
Rating: 1.67 - acadiafinancialpaymentservices.com
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 18 Oct 2019 13:32:07 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Status-Code: 200
Status: 200 OK
Date: Fri, 18 Oct 2019 13:32:07 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information
| Domain Registrar: | Tucows Domains Inc. |
|---|---|
| Registration Date: | 2009-01-27 1 decade 5 years 9 months ago |
| Last Modified: | 2019-10-16 5 years 3 weeks 1 day ago |
| Expiration Date: | 2020-01-27 4 years 9 months 1 week ago |
Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns1.bellcanadahosting.com | 69.156.240.254 | Canada |
| ns2.bellcanadahosting.com | 69.156.247.254 | Canada |
| ns3.bellcanadahosting.com | 64.29.158.254 | United States |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| fectechnologie.com | A | 10799 |
IP: 69.156.240.29 |
| fectechnologie.com | NS | 86400 |
Target: ns2.bellcanadahosting.com |
| fectechnologie.com | NS | 86400 |
Target: ns3.bellcanadahosting.com |
| fectechnologie.com | NS | 86400 |
Target: ns1.bellcanadahosting.com |
| fectechnologie.com | SOA | 10799 |
MNAME: ns1.bellcanadahosting.com RNAME: postmaster.bellcanadahosting.com Serial: 1012 Refresh: 86400 Retry: 3600 Expire: 3600000 |
| fectechnologie.com | MX | 86400 |
Priority: 100 Target: mx2c9.bellcanadahosting.com |
| fectechnologie.com | MX | 86400 |
Priority: 110 Target: mx3c9.bellcanadahosting.com |
| fectechnologie.com | MX | 86400 |
Priority: 10 Target: mx1c9.bellcanadahosting.com |
| fectechnologie.com | TXT | 86400 |
TXT: v=spf1 a mxinclude:spfc9.megamailservers.cominclu de:verticalresponse.com ~all |
Similarly Ranked Websites
Watch JAVHD Online, JAV FullHD, Free JAVHD, JAVHD Streaming, JAVHD...
Rating: 1.67 - javfunhd.com
Watch JAVHD Online, JAV FullHD, Free JAVHD, JAVHD Streaming, JAVHD Uncensored, Censored With High Quality HD-720p FullHD-1080p and Daily ..
Alexa: 6,347,539
Worth: $240.00
Worth: $240.00
Larry DiCara | Boston | Lawrence S. DiCara, P.C.
Rating: 1.67 - larrydicara.com
Larry DiCara is a consultant and lobbyist that has been intimately involved with the development process in and around Boston for more than 40 years.
Alexa: 9,126,596
Worth: $240.00
Worth: $240.00
Walkabout Wanderer - Helping adventure travellers squeeze the most...
Rating: 1.67 - walkaboutwanderer.com
Helping adventure travellers squeeze the most out of the world!
Alexa: 5,157,622
Worth: $240.00
Worth: $240.00
masakanrestoran.com - masakanrestoran Resources and Information.
Rating: 1.67 - masakanrestoran.com
masakanrestoran.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here,...
Alexa: 18,531,641
Worth: $8.95
Worth: $8.95
Alexa Traffic Rank
Alexa Search Engine Traffic
Full WHOIS Lookup
Domain Name: FECTECHNOLOGIE.COMRegistry Domain ID:
1539499824_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.tucows.comRegistrar URL: http://www.tucows.comUpdated Date:
2019-10-16T19:13:15ZCreation Date: 2009-01-27T19:22:36ZRegistry Expiry
Date: 2020-01-27T19:22:36ZRegistrar: Tucows Domains Inc.Registrar IANA
ID: 69Registrar Abuse Contact Email:Registrar Abuse Contact
Phone:Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedDomain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibitedName Server:
NS1.BELLCANADAHOSTING.COMName Server: NS2.BELLCANADAHOSTING.COMName
Server: NS3.BELLCANADAHOSTING.COMDNSSEC: unsignedURL of the ICANN
Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/>>> Last
update of whois database: 2019-10-18T13:32:09Z
1539499824_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.tucows.comRegistrar URL: http://www.tucows.comUpdated Date:
2019-10-16T19:13:15ZCreation Date: 2009-01-27T19:22:36ZRegistry Expiry
Date: 2020-01-27T19:22:36ZRegistrar: Tucows Domains Inc.Registrar IANA
ID: 69Registrar Abuse Contact Email:Registrar Abuse Contact
Phone:Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedDomain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibitedName Server:
NS1.BELLCANADAHOSTING.COMName Server: NS2.BELLCANADAHOSTING.COMName
Server: NS3.BELLCANADAHOSTING.COMDNSSEC: unsignedURL of the ICANN
Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/>>> Last
update of whois database: 2019-10-18T13:32:09Z