fectechnologie.com
value of fectechnologie.com is about $8.95
fectechnologie.com was registered 1 decade 5 years ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, fectechnologie.com is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $0.15 |
| Estimated Worth: | $8.95 |
Search Engine Indexes
| Google Indexed Pages: | 12 |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | 286 |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| PageSpeed Score: | 58 ON 100 |
| Domain Authority: | Not Applicable |
| DMOZ Listing: | No |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Very Poor |
| WOT Privacy: | Very Poor |
| WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
69.156.240.29Hosted Country:
CALocation Latitude:
43.686Location Longitude:
-79.6087Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
| Google+: | Not Applicable |
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | 6 |
| H3 Headings: | Not Applicable | H4 Headings: | 6 |
| H5 Headings: | 1 | H6 Headings: | 6 |
| Total IFRAMEs: | Not Applicable | Total Images: | 20 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 69.156.240.29)
ELITE PERMITS INC - Home
Rating: 1.67 - elitepermitsinc.com
Elite Permits Inc
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Under Construction
Rating: 1.67 - acadiafinancialpaymentservices.com
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 18 Oct 2019 13:32:07 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Status-Code: 200
Status: 200 OK
Date: Fri, 18 Oct 2019 13:32:07 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information
| Domain Registrar: | Tucows Domains Inc. |
|---|---|
| Registration Date: | 2009-01-27 1 decade 5 years 3 months ago |
| Last Modified: | 2019-10-16 4 years 7 months 1 week ago |
| Expiration Date: | 2020-01-27 4 years 3 months 4 weeks ago |
Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns1.bellcanadahosting.com | 69.156.240.254 | Canada |
| ns2.bellcanadahosting.com | 69.156.247.254 | Canada |
| ns3.bellcanadahosting.com | 64.29.158.254 | United States |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| fectechnologie.com | A | 10799 |
IP: 69.156.240.29 |
| fectechnologie.com | NS | 86400 |
Target: ns2.bellcanadahosting.com |
| fectechnologie.com | NS | 86400 |
Target: ns3.bellcanadahosting.com |
| fectechnologie.com | NS | 86400 |
Target: ns1.bellcanadahosting.com |
| fectechnologie.com | SOA | 10799 |
MNAME: ns1.bellcanadahosting.com RNAME: postmaster.bellcanadahosting.com Serial: 1012 Refresh: 86400 Retry: 3600 Expire: 3600000 |
| fectechnologie.com | MX | 86400 |
Priority: 100 Target: mx2c9.bellcanadahosting.com |
| fectechnologie.com | MX | 86400 |
Priority: 110 Target: mx3c9.bellcanadahosting.com |
| fectechnologie.com | MX | 86400 |
Priority: 10 Target: mx1c9.bellcanadahosting.com |
| fectechnologie.com | TXT | 86400 |
TXT: v=spf1 a mxinclude:spfc9.megamailservers.cominclu de:verticalresponse.com ~all |
Similarly Ranked Websites
Home | Sapphire Syndicate Financial Message Board
Rating: 1.67 - sapphirecapital.proboards.com
Alexa: 6,135
Worth: $1,439,640.00
Worth: $1,439,640.00
Diest - Home
Rating: 1.67 - diestconsulting.com
Diest innova para que construya una organización legendaria…Durante 18 años, Diest se ha dedicado a proveer herramientas, soporte y know-how a empresas de todos los tamaños,...
Alexa: 4,609,053
Worth: $240.00
Worth: $240.00
ekisverenler.com - This website is for sale! - ekisverenler...
Rating: 1.67 - ekisverenler.com
This website is for sale! ekisverenler.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to...
Alexa: 11,187,598
Worth: $8.95
Worth: $8.95
Alexa Traffic Rank
Alexa Search Engine Traffic
Full WHOIS Lookup
Domain Name: FECTECHNOLOGIE.COMRegistry Domain ID:
1539499824_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.tucows.comRegistrar URL: http://www.tucows.comUpdated Date:
2019-10-16T19:13:15ZCreation Date: 2009-01-27T19:22:36ZRegistry Expiry
Date: 2020-01-27T19:22:36ZRegistrar: Tucows Domains Inc.Registrar IANA
ID: 69Registrar Abuse Contact Email:Registrar Abuse Contact
Phone:Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedDomain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibitedName Server:
NS1.BELLCANADAHOSTING.COMName Server: NS2.BELLCANADAHOSTING.COMName
Server: NS3.BELLCANADAHOSTING.COMDNSSEC: unsignedURL of the ICANN
Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/>>> Last
update of whois database: 2019-10-18T13:32:09Z
1539499824_DOMAIN_COM-VRSNRegistrar WHOIS Server:
whois.tucows.comRegistrar URL: http://www.tucows.comUpdated Date:
2019-10-16T19:13:15ZCreation Date: 2009-01-27T19:22:36ZRegistry Expiry
Date: 2020-01-27T19:22:36ZRegistrar: Tucows Domains Inc.Registrar IANA
ID: 69Registrar Abuse Contact Email:Registrar Abuse Contact
Phone:Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibitedDomain Status:
clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibitedName Server:
NS1.BELLCANADAHOSTING.COMName Server: NS2.BELLCANADAHOSTING.COMName
Server: NS3.BELLCANADAHOSTING.COMDNSSEC: unsignedURL of the ICANN
Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/>>> Last
update of whois database: 2019-10-18T13:32:09Z