fallspremierball.com
value of fallspremierball.com is about $8.95
fallspremierball.com was registered 2 decades 2 years ago. It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, fallspremierball.com is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $0.15 |
| Estimated Worth: | $8.95 |
Search Engine Indexes
| Google Indexed Pages: | 122 |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | 205 |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| PageSpeed Score: | 87 ON 100 |
| Domain Authority: | Not Applicable |
| DMOZ Listing: | No |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Very Poor |
| WOT Privacy: | Very Poor |
| WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
69.156.240.29Hosted Country:
CALocation Latitude:
43.686Location Longitude:
-79.6087Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
| Google+: | Not Applicable |
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 6 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 69.156.240.29)
ELITE PERMITS INC - Home
Rating: 1.67 - elitepermitsinc.com
Elite Permits Inc
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Under Construction
Rating: 1.67 - acadiafinancialpaymentservices.com
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
Domain Information
| Domain Registrar: | Arq Group Limited DBA Melbourne IT |
|---|---|
| Registration Date: | 2001-10-09 2 decades 2 years 8 months ago |
| Last Modified: | 2019-10-10 4 years 8 months 1 week ago |
| Expiration Date: | 2020-10-09 3 years 8 months 1 week ago |
Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns1.bellhosting.com | 69.156.240.252 | Canada |
| ns2.bellhosting.com | 69.156.247.252 | Canada |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| fallspremierball.com | A | 10799 |
IP: 69.156.240.29 |
| fallspremierball.com | NS | 86400 |
Target: ns1.meganameservers.com |
| fallspremierball.com | NS | 86400 |
Target: ns2.meganameservers.com |
| fallspremierball.com | NS | 86400 |
Target: ns3.meganameservers.com |
| fallspremierball.com | SOA | 10799 |
MNAME: ns1.meganameservers.com RNAME: postmaster.meganameservers.com Serial: 2006071717 Refresh: 86400 Retry: 3600 Expire: 3600000 |
| fallspremierball.com | MX | 86400 |
Priority: 110 Target: mx3c9.megamailservers.com |
| fallspremierball.com | MX | 86400 |
Priority: 1 Target: mx1c9.megamailservers.com |
| fallspremierball.com | MX | 86400 |
Priority: 10 Target: mx2c9.megamailservers.com |
Similarly Ranked Websites
dalalok – موقع دلالك موقع يهتم بكل مايخص المرأة العربية
Rating: 1.67 - dalalok.com
Alexa: 12,741,570
Worth: $8.95
Worth: $8.95
The Market Papers – A Tech Magazine
Rating: 1.67 - themarketpapers.com
Alexa: 6,127,757
Worth: $8.95
Worth: $8.95
FinanceShed Credit , Investing ,Planning , Goals & Saving
Rating: 1.67 - financeshed.net
The best source of Finance Services, Saving, Credit & Investing and Planning.
Alexa: 1,099,131
Worth: $720.00
Worth: $720.00
Alexa Traffic Rank
Alexa Search Engine Traffic
Full WHOIS Lookup
Domain Name: FALLSPREMIERBALL.COM
Registry Domain ID: 78450790_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.arq.group
Registrar URL: http://www.melbourneit.com.au
Updated Date: 2019-10-10T13:28:35Z
Creation Date: 2001-10-09T20:22:56Z
Registry Expiry Date: 2020-10-09T20:22:56Z
Registrar: Arq Group Limited DBA Melbourne IT
Registrar IANA ID: 13
Registrar Abuse Contact Email: abuse@melbourneit.com.au
Registrar Abuse Contact Phone: +61.386242300
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited Name Server: NS1.BELLHOSTING.COM Name Server: NS2.BELLHOSTING.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/ >>> Last update of whois database: 2019-10-13T22:42:59Z
https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited Name Server: NS1.BELLHOSTING.COM Name Server: NS2.BELLHOSTING.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/ >>> Last update of whois database: 2019-10-13T22:42:59Z