elitepermitsinc.com
value of elitepermitsinc.com is about $8.95
Elite Permits Inc It is a domain having .com extension. It is estimated worth of $8.95 and have a daily income of around $0.15. As no active threats were reported recently, elitepermitsinc.com is SAFE to browse.
Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable
Income Per Day: $0.15
Estimated Worth: $8.95
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $0.15 |
| Estimated Worth: | $8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| PageSpeed Score: | 59 ON 100 |
| Domain Authority: | 80 ON 100 |
| DMOZ Listing: | No |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Very Poor |
| WOT Privacy: | Very Poor |
| WOT Child Safety: | Very Poor |
Web Server Information
Hosted IP Address:
69.156.240.29Hosted Country:
CALocation Latitude:
43.686Location Longitude:
-79.6087Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
| Google+: | Not Applicable |
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | 9 |
| H3 Headings: | 4 | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | 2 | Total Images: | 717 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 69.156.240.29)
Under Construction
Rating: 3.00 - acadiafinancialpaymentservices.com
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Nova Envirocom Inc Home
Rating: 3.00 - chocdemolition.com
Nova Envirocom Inc
Alexa: Not Applicable
Worth: $8.95
Worth: $8.95
Backlink History Chart from Majestic SEO
Referring Domains Discovery Chart from Majestic SEO
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 12 Feb 2020 11:16:44 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: Apache
Vary: Accept-Encoding
p3p: CP="CAO PSA CONi OTRo OUR ONL"
Access-Control-Allow-Origin: https://img-to.nccdn.net
Access-Control-Allow-Methods: GET
Access-Control-Allow-Headers: accept, x-request, x-requested-with
Strict-Transport-Security: max-age=31536000; includeSubDomains
X-Content-Type-Options: nosniff
Content-Encoding: gzip
Status-Code: 200
Status: 200 OK
Date: Wed, 12 Feb 2020 11:16:44 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: Apache
Vary: Accept-Encoding
p3p: CP="CAO PSA CONi OTRo OUR ONL"
Access-Control-Allow-Origin: https://img-to.nccdn.net
Access-Control-Allow-Methods: GET
Access-Control-Allow-Headers: accept, x-request, x-requested-with
Strict-Transport-Security: max-age=31536000; includeSubDomains
X-Content-Type-Options: nosniff
Content-Encoding: gzip
Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns3.meganameservers.com | 209.235.144.105 | United States |
| ns1.meganameservers.com | 69.49.97.150 | United States |
| ns2.meganameservers.com | 209.235.143.97 | United States |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| elitepermitsinc.com | A | 21599 |
IP: 69.156.240.29 |
| elitepermitsinc.com | NS | 21599 |
Target: ns3.meganameservers.com |
| elitepermitsinc.com | NS | 21599 |
Target: ns1.meganameservers.com |
| elitepermitsinc.com | NS | 21599 |
Target: ns2.meganameservers.com |
| elitepermitsinc.com | SOA | 21599 |
MNAME: ns1.meganameservers.com RNAME: postmaster.meganameservers.com Serial: 2019032015 Refresh: 86400 Retry: 86400 Expire: 3600000 |
| elitepermitsinc.com | MX | 21599 |
Priority: 30 Target: ALT2.ASPMX.L.GOOGLE.com |
| elitepermitsinc.com | MX | 21599 |
Priority: 10 Target: ASPMX.L.GOOGLE.com |
| elitepermitsinc.com | MX | 21599 |
Priority: 20 Target: ALT1.ASPMX.L.GOOGLE.com |
| elitepermitsinc.com | MX | 21599 |
Priority: 40 Target: ASPMX2.GOOGLEMAIL.com |
| elitepermitsinc.com | MX | 21599 |
Priority: 50 Target: ASPMX3.GOOGLEMAIL.com |
| elitepermitsinc.com | TXT | 21599 |
TXT: google-site-verification=1BOku14Sh6pzfxe Xun8zRwNgQDH8jfrRrm6hy2YqVNo |
Similarly Ranked Websites
Hard Water Stains | Cloudy Dishes | Dishwasher Detergent
Rating: 3.00 - citriclean.net
CitriClean will make your dishes shine again! It's an all-natural additive that works with your dishwasher detergent to remove the cloudy or gritty hard water
Alexa: 6,664,293
Worth: $8.95
Worth: $8.95
tnd2019.org - This website is for sale! - tnd2019 Resources...
Rating: 3.00 - tnd2019.org
This website is for sale! tnd2019.org is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find...
Alexa: 11,031,161
Worth: $8.95
Worth: $8.95
Apache HTTP Server Test Page powered by CentOS
Rating: 3.00 - vpnrv.com
Alexa: 10,724,663
Worth: $8.95
Worth: $8.95
Apache HTTP Server Test Page powered by CentOS
Rating: 3.00 - fitsexlife.com
Alexa: 5,611,809
Worth: $240.00
Worth: $240.00